KEGG   Danio rerio (zebrafish): 100170201
Entry
100170201         CDS       T01004                                 

Gene name
ccl35.2
Definition
(RefSeq) chemokine (C-C motif) ligand 35, duplicate 2 precursor
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: IL8 OrfB_Zn_ribbon
Other DBs
NCBI-GeneID: 100170201
NCBI-ProteinID: NP_001123366
ZFIN: ZDB-GENE-140718-1
Ensembl: ENSDARG00000070378
UniProt: A9ZPD8
Position
25
AA seq 98 aa
MSTSRFVFLSAVVVLLCAVSLSQGMRIGPKRCCFQYAERQVPFKQVMEYSMTSQQCPKEA
VLFKTARGRYVCARPSDPWVQEYMQAIDSKRVGSQGTL
NT seq 297 nt   +upstreamnt  +downstreamnt
atgagcacctctcgctttgtgtttttatctgctgttgtggtgctgctgtgtgccgtaagc
ctcagtcaaggtatgcgcattggaccaaagagatgctgtttccagtatgcggaacgtcaa
gtgcctttcaaacaagtaatggaatacagcatgacaagccagcagtgccccaaagaagcc
gtcctgttcaagactgcaaggggacgttacgtgtgtgccagacccagtgatccctgggta
caggagtacatgcaggccattgacagcaaacgtgttggcagtcaggggaccctttaa

DBGET integrated database retrieval system