KEGG   Danio rerio (zebrafish): 100320289
Entry
100320289         CDS       T01004                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    100320289 (adamts13)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100320289 (adamts13)
Peptidases and inhibitors [BR:dre01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100320289 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 TSP1_CCN Reprolysin_4 Reprolysin_3 Reprolysin_5 TSP1_spondin Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 100320289
NCBI-ProteinID: XP_002663267
ZFIN: ZDB-GENE-070814-7
Ensembl: ENSDARG00000076270
Vega: OTTDARG00000026986
UniProt: A0A286Y999
Position
8
AA seq 1498 aa
MQQPNMENVFWLFLVLSLLTAVFSKSSVLISQCTLQKDFLDSLKPQDLFYYFDTISTKSV
PPFEIVWVNCSRNESIKGLWRCLFQTKGESFELVQHSAKQAVSCPTSLEMIINSTVSMVK
KREDMCCEQLKLLRPTHTRTLLPVCYGKLQGLIQSGEMRLYIRPVLEQHIDNLKDLTMDL
PPGVPHLLITQTLPVRTRLKQPKSQFRLRRSPLRSEVTYLELAVVVGPDVYEVHRQDTER
YILTNLNIASELLRDVTLGANIRVHLVRMIILTEPEPDIQISENITSSLKSVCEWGQKVN
PDADSDPLHADLLLYITRFDLVLPNGNKLVRGVTQFGGVCSTQWNCVITEDTGFDLGITI
AHEIGHSFGINHDGIDNTCSSSGFMMASDGGYNSVDLTWSQCSRAQLYSFFRAGKAECVQ
DVPVLGGSVQDWRPGLFYGVDDQCRIAFGSSATACSFTNEDMTTCRVLSCHINPQDHSSC
TRLLVPLLDGTECGPSQWCLKGRCVSPSTSGSSMMVHGSWSAWSDFSPCSRTCGGGITHR
RRQCNNPRSAFGGTICKGQNTEAELCNLQLCDSTQLEFMARQCSATDQQPLSVSTDSKSM
YTWIPAISYSSGDSQCKLMCRSREQDFMVSRGSQFIDGTRCESDNPVPHGSISACLSGKC
QLFGCDGALHSGKVEDVCGVCGGNGSTCHLISNTYSGGKAGEYVTFLTLPLNASQVHVFN
TRSIFTHLAVLLNDKYVVSGNGKPGLSNTYPSPLEKSLITYKLYLTPDHLPQTEELYISG
PVTDKIHLQVYRKYGQEYGDLTNPNISYQYYSDDVIVEIASKGKWSTTISACSVTCGRGI
QKIYQHCVDLVTLEHLKDELCSSLPRSSDLLQPCFLPDCPPRWQVSEPGECSTVCGPGEA
QRKVFCVRFHNKSYLEVDQNLCSQPKPPEYVPCVVDVCPLKWDTENETQLIHRASHGMVR
SKIVPVYVWSPRTGECSKTCGNGSQQVQFSCVDHKSRLEVPETLCDPTTKPAQDTQPCRI
SLCLPIWRYIQGPCSVSCGGGIAKRVLFCSQRMEENDGNNDLVVGETACDSVPKPPEVVE
CNTEKCKARWQVGDQGDCSVTCGMGVALRSVQCVQYEGGVERDVEEEKCESETKPPVTVP
CFTQVCSFNWDVHDWSKCSVSCGYGIQSRAVSCMGPSNPFPLSPFLCLHLPKPITIQACY
SPDCSSVNTSESKPNSTYIQSTLQSIEGMWKSPNMQTTPAPAVRRIKMKKSFPTIVPTAD
MMTSTMSVPTETPQTSICGQLLLQDSGNIDLRNVTERRCIFAIGRPLDEVIQIRIISSTL
NCQQKENIALYDRLVLMRLCERMTGKMVKSRTNVLLVRQNRLTSGNGVVLFYQSVKTNKG
YNRVCDVQLFAPSGLIENPIKSPATYPSNTQSCRVFIDAPPALRVQIRALSVLNNTDTNS
TYILIRDVDALKTTIFRGTQLFLWRSSGSRAEVEFHGEYQQIKGMFRAEYLHINPSEE
NT seq 4497 nt   +upstreamnt  +downstreamnt
atgcagcagccaaacatggaaaacgtgttctggctctttctagttctaagcttgttaaca
gctgtatttagtaaatcatctgtattgatttcacaatgcactctgcagaaggatttttta
gattcactgaaacctcaagatttattttattattttgatactatttctactaaatcagtg
cctccctttgagatagtgtgggtgaactgctcaaggaatgagtctatcaaaggactgtgg
aggtgtttgtttcagaccaaaggagagagctttgagctggtccaacacagtgctaaacaa
gcagtgtcctgtcccacaagtctagagatgataataaattcaacggtcagcatggtgaag
aaaagagaggatatgtgttgcgagcagctgaagttactacgaccaacgcatacaagaaca
cttctccctgtctgctatggaaaattacaaggtttgattcagtcaggagaaatgaggctg
tatattcgcccagtgctcgaacagcacatagacaatctgaaggacctaactatggattta
cctcccggtgttcctcatttgctaataactcagacattaccagtgaggacacgtcttaaa
cagcccaagagtcagttcaggttacggaggtcacctctgaggtcagaggtcacatatctg
gagctagcagtggttgttggtcctgatgtctacgaagttcatcggcaagacactgagaga
tacatcttaaccaacctcaacattgcctctgagcttttgagagatgttaccctcggtgcc
aatataagggttcaccttgtccgtatgatcattcttacagagccagagccagacatccag
atctcagaaaacatcacatcatctttaaaaagtgtttgcgaatggggtcagaaggtcaat
cctgatgctgacagtgatcctttacatgcagatctactgttatatattaccaggtttgat
ctggtgttacccaatgggaataagcttgtgagaggtgtaactcaatttggtggagtctgt
tccactcaatggaactgtgttattacggaggatacaggctttgatcttggcatcactatt
gctcatgagattggccacagttttgggataaatcatgatggaatagataacacatgcagc
tctagtggctttatgatggcatctgatggaggttataacagcgtcgatctcacctggtcc
caatgcagcagggctcagctctacagcttcttcagagctggtaaggcagagtgtgttcag
gatgtgccagtgttgggtggttcagtgcaggactggaggcctggtcttttctatggagtg
gacgatcagtgccgtatagcgtttggcagctcagcaactgcttgctctttcactaatgaa
gacatgacaacttgccgtgttctgtcctgccatattaaccctcaggatcatagctcatgc
actcgtcttcttgtgccactcctggatggaacagagtgtgggcccagtcagtggtgttta
aaaggtcggtgtgtgtccccttctacttcgggctcttccatgatggtgcatggctcatgg
tctgcatggtctgacttctctccttgctcacgaacatgtggaggaggaatcactcaccgc
aggaggcaatgcaacaaccctaggtcagcctttggtggaaccatctgtaaaggacagaat
acagaagctgaactttgtaatcttcagctttgtgattcaactcagcttgagttcatggct
cgtcagtgctcagccacagaccagcagcctctgtcagtatctacagactctaagtcaatg
tatacctggatccctgctataagctacagctcaggtgactctcagtgtaaactgatgtgt
cgttcacgtgagcaggacttcatggtgagtcgtgggtctcagttcattgatgggacgcgg
tgtgaatctgataatcccgtaccacatgggtcaatctctgcatgtctaagtggaaaatgc
cagctgtttggctgcgatggagcattgcattctggaaaggtggaagatgtgtgtggggtg
tgtggaggcaatggctccacatgtcacttaatttcaaacacttattcaggtggaaaggct
ggagagtatgtgacattcctcacccttcccctgaatgcctctcaagttcatgttttcaac
acacggtcaatttttacacatcttgctgtgttattaaatgataaatatgttgtttctgga
aatggaaagccagggctaagcaatacatacccctcacctctggagaagagccttataacg
tataaactatacctcacacctgaccacctacctcaaactgaagagctctatatttctgga
ccagtcacagacaaaatccacttacaggtgtatcggaaatatggacaagagtatggagac
ctcaccaatccaaatatctcataccagtactactcagatgatgttatagtggaaatagct
tcaaagggcaaatggtccactaccatatctgcctgctcagtgacctgtggaagaggcatc
cagaaaatttatcaacactgtgtggatctggtcacacttgaacacctgaaagatgagctc
tgcagttcactacctcggtcgtctgacctgctgcagccctgcttcctgccagattgccca
cccagatggcaggtctctgagcctggtgagtgctccactgtatgtggtcccggggaggcc
caaagaaaagtcttctgtgtccgcttccataataaatcttatttggaggttgaccaaaac
ctgtgctctcaacccaaacccccagaatacgttccctgtgtggtggatgtttgccctctc
aaatgggacactgaaaatgagacccagctgatccatagagcttctcatggaatggttcgc
tccaaaattgttccagtttacgtttggagtcccaggacaggcgagtgctccaagacttgt
ggaaatggatctcagcaggttcagttctcttgtgttgatcacaaatcacgtctggaagtc
ccagagaccctttgtgatccaaccaccaaaccagcacaggacactcaaccttgtcgcata
tcactatgcctccctatctggcgctacatacaggggccatgcagtgtgtcttgtggaggt
ggaatagcaaagagagtcctgttttgttcacagaggatggaggaaaatgatggaaacaat
gatctagtggtgggagaaactgcttgtgattctgtgcccaaacctccagaggtagtggaa
tgtaatactgaaaaatgtaaagccaggtggcaggtgggagaccagggtgactgttccgtc
acttgtgggatgggtgttgctctcaggagtgtgcagtgtgttcagtatgagggcggtgta
gaaagggatgtggaggaggaaaaatgtgaatcagaaaccaagcctcctgtcactgtacca
tgcttcacacaagtctgttctttcaactgggatgtgcacgactggagtaagtgttcagta
tcatgtggttatgggatccagtctcgggctgtgtcctgcatgggcccatcgaatccattc
cctcttagtccctttctttgcctccacttgccaaaacctatcaccatccaggcctgttat
agccctgactgctcctcagtcaatacatctgaatcaaagcccaacagcacttacatccag
tcaactctccaaagtattgaggggatgtggaaaagtccaaacatgcaaaccacaccagct
ccagcagtcagacgtatcaagatgaagaagagtttcccaaccattgttcctacagcagac
atgatgacgagcactatgagcgtgccaacagaaacaccacagaccagtatctgtgggcaa
ctcctgcttcaagactcaggaaatattgatctccgcaatgtcactgagaggagatgcata
tttgctattggccgacctcttgatgaggttattcaaatcagaattatttccagtaccctt
aactgccagcaaaaggagaatatagccctgtatgacagacttgtccttatgcgtctttgt
gagaggatgactggtaaaatggtcaaatcacgaacaaatgttcttttggtacgccaaaac
cgtctcacctctggcaatggagtggtactattttatcaaagtgtaaagacgaataaaggc
tacaatagagtgtgtgatgttcaactgtttgctccttccggacttattgagaatccgatc
aagagtccagccacttacccctctaacacccagagctgtcgtgtgttcattgatgctcct
cctgctttgagagttcaaatcagagcactttctgttctcaacaatacagacacaaactca
acatacatattgattcgagatgtggatgctttaaagacaaccatatttagaggaacacag
ctcttcctgtggagatcttcaggaagcagggctgaagtggaatttcatggggagtatcag
caaatcaaaggaatgtttagagcagagtatttgcatattaacccttctgaagaataa

DBGET integrated database retrieval system