KEGG   Danio rerio (zebrafish): 100332219
Entry
100332219         CDS       T01004                                 
Symbol
si:zfos-2070c2.3
Name
(RefSeq) rano class II histocompatibility antigen, A beta chain-like
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: C1-set MHC_II_beta C2-set_2 Ig_3
Other DBs
NCBI-GeneID: 100332219
NCBI-ProteinID: XP_009302413
ZFIN: ZDB-GENE-091204-413
Ensembl: ENSDARG00000076307
UniProt: A0A0R4ISW2 A0A8M3AVD5
Position
8:complement(36398615..36412858)
AA seq 253 aa
MSLIKLSCCPPILALFVLIGAENANEYYATELSRCIYTSHDLSDMVFIDNYYFNKHLVTQ
FNSTLGKFVGFTEYGIKNAEIWNNSSLLQKEISNVDSECRFYIKTRDKAVRDKAVKPTVV
LSSVTQANGRHPAMLICSAYEFYPRHIKVSWLKGGKSVTSEVTSTMEMADGDWYYQIHSE
LEYTPGPGEKISCLVEHASSSEPMIYDWDPSLPESERNKIAVGASGLVMGFIIAAVGILY
YRKKSTGMIPIPH
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtctctaataaaactatcatgctgtcctcctatattggcactatttgtactgattgga
gccgaaaatgctaatgaatattacgcaaccgagttgtcaagatgcatctacacctctcat
gatctaagtgatatggtgtttattgacaactactattttaataaacatctagtcacacag
ttcaacagcactctggggaaatttgtagggtttacggagtatggaataaaaaatgcagaa
atctggaacaatagttccttgctgcaaaaagagatatctaatgttgattctgaatgcaga
ttttacattaaaaccagagacaaagccgtccgtgataaagcagtgaagccaacagttgtg
ctcagttcagtaacacaggcgaatggaagacatccagctatgttaatctgcagtgcgtat
gaattttatcctcgacacatcaaagtgtcctggctaaaaggcggtaaatcggtgacctct
gaagtgacctccactatggagatggctgatggtgactggtattaccagatccactctgag
ctggagtacacacccggacctggagagaagatctcctgtttggttgagcacgccagctcc
agtgaacccatgatttatgactgggatccatctcttcctgaatctgagaggaataaaatc
gctgttggggcatctggtttggtgatgggattcataatagcggctgttggaatcttatac
tacagaaaaaaatcaacaggaatgattcccatacctcattaa

DBGET integrated database retrieval system