KEGG   Danio rerio (zebrafish): 100333199
Entry
100333199         CDS       T01004                                 

Gene name
syde2
Definition
(RefSeq) rho GTPase-activating protein SYDE2
  KO
K20655  Rho GTPase-activating protein SYDE
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    100333199 (syde2)
Membrane trafficking [BR:dre04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    100333199 (syde2)
SSDB
Motif
Pfam: RhoGAP C2 DUF5024
Other DBs
NCBI-GeneID: 100333199
NCBI-ProteinID: XP_017209238
ZFIN: ZDB-GENE-121116-6
Ensembl: ENSDARG00000099479
UniProt: A0A0G2KK80
Position
23
AA seq 719 aa
MKMKKLPDLSRKLSVKGNPINNVPVNNIQSEPRAHSPRVNGMADLGPSRLPPAGVTTALA
SGNVIWRYHLDSSVSTQHSFDKRRSNSAGVPKSASKGGYLSDGDSPELVAKSGKHTNSER
KNCKTRDPNGNGGSPKLPGTELDIDAFRSYSFTEQPKCLTYISGLMSLHFYGAEDLKLPR
VDSRDIYCAIQVDSVNKARTALLTCRTSFLDMDHTFNIELENAQHLKLVVFSWESTPRRN
RVCCHGTVVLPGLFRVSKTHQLAVRLEPRGMIYVKLSLMEQRQNSLDGDHPQMQVFGVEA
RHVVEREASGLMVPLLIEKCISEIERRGCQVVGLYRLCGSAAVKKELREAFERDSHSVEL
SESNYPDINVITGVLKDYLRELPHPLITQQLYECVLEAMMKRPLLMGNAGCENTPADSQL
TVSLLDILPDVEKASLKKLLDHLKRVASHHELNKMPCQNLAVCFGPVLLSQRQEASSQAK
RVFIDSEELASALHFKKHIEVLHYLLQLWPVVDAHGKPSSPVPVAATAVRRRKERPQVLN
LTEVHVTGVLRPRAGRLDSPSNRYAGDWSGCQDSYLQQTSLEEADYDDVPSEEPLNTGQE
DLPKSSADEEEFPEVEEAAERVEEMQIEEEEDESDEDETGGLDRLQIEEPLSISSCDEIL
PDPMEHQPKEHTYQAYMKIQEISPVLSNRVNLRDLQESIDTLIGNLERELNKNKLNLGY
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgaagatgaagaagctgcctgatctgagtcggaagctcagtgttaaaggcaaccctatt
aacaatgtgcccgtcaataatatccaatcagagcccagggctcactcaccgagagtcaat
ggaatggcagatctgggcccatccagactgccccctgctggcgtgaccacggctttggcc
agcggaaacgtgatctggcgataccatctggacagcagtgtttcaacacagcacagtttc
gataagcggagaagcaacagtgctggagttcccaaatctgcaagtaaaggaggatacctc
agtgacggagattcaccggaacttgtggccaaatcaggcaagcatacaaactctgaaaga
aagaactgcaaaacgcgggatcccaacggaaacggtggaagtcccaaactccccggtaca
gagttggatatcgatgctttccgttcgtacagtttcaccgagcagccaaagtgcctaact
tatatttcgggactaatgagtctgcatttctatggcgcagaagatttgaagctgccgcgg
gttgattcccgggacatctactgcgccattcaggtggactcggtcaataaagctcgtacg
gctttgctaacctgtcgcacatcgtttcttgacatggaccacacctttaatatcgagctg
gagaacgctcagcatctcaaacttgttgtcttcagctgggagtcgactccgcgacggaac
cgagtgtgctgtcatgggaccgtagttctgccgggattatttcgagtcagtaaaacacac
cagctggcagtgcgtctggagccgcgcgggatgatctatgtaaagctgagcctgatggag
cagaggcagaactcgctggacggagatcatccccaaatgcaggtgttcggggtggaggcg
cggcatgtggtggagcgggaggcgtccgggctcatggtcccgctgctcatcgagaaatgc
atctctgagatcgagaggaggggttgccaggtggtgggtctgtaccgtctctgcggttct
gctgcggtgaagaaggagctgcgcgaagctttcgagagagacagtcacagcgtggagctc
tcggaaagcaactatccagacattaacgtcatcacaggagtgctgaaagattacctccgt
gagctcccgcatccgctcatcacgcagcagctgtatgagtgtgttctggaggccatgatg
aagcggccgctgctgatgggaaacgccggctgtgaaaacacaccagccgactcccagctc
accgtcagcctgctggacatcctgcctgatgtggagaaggcaagtctgaagaagctgctg
gaccacctgaagcgtgtggcgtctcatcacgagctcaacaagatgccgtgtcagaatctg
gcggtgtgtttcgggccggttctgctgagtcagcggcaggaggcgtccagtcaggccaag
cgcgtcttcatcgactctgaggagctggccagcgctctgcacttcaagaagcacatcgag
gtgctgcactacctgctgcagctgtggccagttgtggatgctcacggtaaaccttcatct
ccagttccagtggcggcgactgctgtacgaaggaggaaagagcgtccgcaggtgctgaat
ctcactgaggtgcacgtgactggggtactgcggcctcgagcgggtcgattagacagtccc
agtaaccgctacgctggagactggagcggatgtcaggactcatacctgcagcagaccagc
ctggaggaggccgactatgatgatgttcccagcgaagagcctctaaacacaggccaggag
gacctaccgaagagttctgcagatgaagaagagtttcctgaggtggaggaggcagcggag
agggttgaggaaatgcagattgaggaggaggaagatgagagtgatgaagatgagacggga
ggattagacaggctacaaatagaggaaccgctgtctattagctcctgcgacgagatcctg
ccagatcccatggagcaccaacccaaagagcacacttaccaggcctacatgaagatccag
gagatcagcccagtactaagcaatagagtcaacctgcgggatctgcaggagagcatcgac
acacttatcggcaacctggagcgggaacttaacaagaacaagctcaacctagggtactga

DBGET integrated database retrieval system