KEGG   Danio rerio (zebrafish): 100333282
Entry
100333282         CDS       T01004                                 

Gene name
esco1
Definition
(RefSeq) N-acetyltransferase ESCO1 isoform X2
  KO
K11268  N-acetyltransferase [EC:2.3.1.-]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    100333282 (esco1)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     100333282 (esco1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    100333282 (esco1)
SSDB
Motif
Pfam: Acetyltransf_13 zf-C2H2_3
Other DBs
NCBI-GeneID: 100333282
NCBI-ProteinID: XP_002663315
ZFIN: ZDB-GENE-130530-818
Ensembl: ENSDARG00000077057
Vega: OTTDARG00000039110
UniProt: X1WEK0
Position
24
AA seq 931 aa
MPGQKRKMSSSEPEVKKTKLDRNLVESDKSQKPKRGRPPKSKVLEAQPSRQKHQIDSREE
NGKPIRRSSRLKTPLKKGARARRRKDGEKPKVSEEKSSQKMPVLKKGNKKYVSRVKREKP
IISETIKTVAAMFPVQIEHNYGRLFDMQAEEITLPKPDKIHVANKSEMQALHETQASKAE
EQKELHAEPVEKITVSVDAKVDVMSKSPPPLEALFKVIQESSLTKHSFSGKDISDMDELE
VVNTCSLQDSVQSTDVAKVFLQDSDAFLDDDVEIENCVVEIETYEDLDGDQGEVSKKQTS
ECVTCKEVNSSPSLPQESATDSSQELPKKQAMNPQARTKARLAALAEERAAAAKKPPPRH
FNLLALCEEIADDIASDAPGASDKTTNEQQQEDHESEDVSECTEVSESKDASESKEVNES
KDLSESKDASESKDVSENKEVSETETCEPEEVVSENTAPPGTPNEETADPRPEDGTPKKR
FFLSQMSVPLKTQEKKKLSRFQRLRQVELQRDKLTWTRVKKLKSDQVNQAGSQKDSEASS
VSPSPATTPAQVPTTESVPKVGSVEPKRVLPAQAPPMPNGITSPKPKPVVEYKPYTPRRK
YSPDDFELDGFEEDTAKPAAPKNVGKAEQSPSSAKVQPNPAVERKLCVPTTADSKSKSSP
QQETAQQTQLENSNSVEPEQKKEDKNSPKPESPAAQSSNEAGQKAFGAVTCNVCGMLYSP
TSAEDESQHLLFHNQFISAVRYVGWKKERILGEYPDGKIILVLPDDPKYALKKVEEIREM
VDNDLGFQQVESKVPSQTKTFLFISNDKKVAGCLIAEHIQEGYRVIEESVLEGSEGEKVM
YERQRAWCCSTVPEPALCGISRIWVFSMMRRRGIASRMIECLRNNFIYGSHLSKDEIAFS
DPTPDGKLFATHYCGTSQFLVYNFVSGKRST
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgcctgggcagaaaagaaagatgtcttcttctgaacctgaagttaaaaaaacaaagctg
gaccgaaatcttgtggagtctgataaatctcaaaagcctaaaagaggaagaccaccaaaa
agtaaagtgctggaagcacagccatcaagacagaaacatcagatagattcaagggaagaa
aatggaaagcctattcgacggtcctctcgcttgaaaacaccactaaaaaaaggtgctaga
gcaagacggcggaaagatggggagaagcctaaagtctctgaggagaagtcctctcaaaaa
atgcctgtcctgaaaaaaggaaacaagaagtatgtttcaagagtaaagagagaaaagccc
atcatctctgaaaccatcaaaacagtagcagccatgttccctgtgcaaatagagcacaat
tacggacgattgtttgacatgcaggctgaagagatcacgctacctaaacctgacaaaatc
catgtggctaataaaagtgaaatgcaggcgcttcacgaaacacaagcaagcaaagctgaa
gagcaaaaagagctgcacgctgagcctgttgagaaaattaccgtcagcgtagatgcaaaa
gtagacgtgatgagcaaatctcctccacctctagaggctcttttcaaagtcatccaagag
tccagcctcactaaacactcattctctggcaaagacatttctgatatggatgagttggaa
gtagtgaacacatgttcactgcaggacagtgtgcaaagcacagacgtggccaaagtgttt
cttcaagactcggatgcatttctggatgatgatgtagagattgaaaactgtgttgtggag
attgaaacctacgaggatttggatggcgatcaaggggaggtgtcgaaaaagcaaacaagc
gaatgtgtgacctgtaaagaggtcaattcttcaccttctttgccccaagaaagtgcaaca
gactcttctcaagagcttccaaaaaagcaagcgatgaacccacaggctcgaacgaaagca
cgtctggcagctttagctgaggaaagagcggctgccgccaagaaacccccaccgagacac
ttcaacctcctggctctctgtgaggaaatcgcagatgacatcgcatctgatgctccagga
gcttcagacaagacaacgaatgagcaacaacaggaggatcatgaatctgaagacgtgagt
gagtgtacggaagtcagtgaatcaaaagatgcgagtgaatcgaaggaagtgaatgaatca
aaagacctgagtgaatctaaagatgcaagtgaatctaaggatgtgtctgaaaataaagag
gtttctgaaactgagacgtgtgaacctgaggaggtggtctctgaaaacacggctcctcct
ggaacacctaatgaagagaccgctgatcccaggcctgaggacggtacgcctaagaaacgt
ttttttcttagccagatgtctgtgcctctcaaaacacaggagaagaagaaactctcccgc
tttcagaggctcaggcaggtggagcttcagcgggataagctgacttggacacgtgtgaag
aagctgaagtctgatcaggtcaatcaggctggctctcaaaaggatagcgaagcttcgtca
gtctcgcccagccctgccaccacccctgcccaggttcctactacagaaagtgtgccaaaa
gtgggctcggttgaacccaaacgggtgctcccggctcaggcgccacccatgcctaatgga
atcaccagcccgaaacccaaaccagtggtggagtataaaccctacactcccagacgcaag
tattcaccggatgactttgagctcgacggttttgaagaggacaccgctaaaccagcagca
cccaaaaatgtgggtaaagcagaacagtccccatcatcagctaaagtgcagcccaatcca
gcagtggagagaaagctgtgtgttcccactaccgcagatagtaagtcgaaatcctctcct
cagcaagaaactgcccaacaaacacaactggaaaacagcaacagtgttgaaccagaacag
aagaaagaggacaaaaacagtcccaaacctgaaagtccagcagcacagtccagcaatgaa
gcgggtcagaaggcgtttggtgcggtcacttgtaacgtgtgtgggatgctttactctcct
accagcgccgaagacgaatcccaacacctcctcttccacaaccagttcatcagcgccgtc
agatacgtgggctggaaaaaagagaggatcctgggagaatatcctgatggcaagattatt
cttgttctccctgatgatccgaagtatgcattgaaaaaggttgaggagatcagagaaatg
gtggataatgatttgggcttccagcaagtcgagagcaaagtcccgtcacagaccaaaacc
ttcctcttcatttcaaacgataagaaagttgcaggctgccttatagcagagcacatacaa
gagggctacagggttattgaggagtccgtgctggagggttcagaaggagagaaggtgatg
tatgagcgtcagagggcctggtgctgctctactgttcccgaacctgcgctctgtggcatc
agccgcatttgggtgttcagcatgatgagacggaggggcatcgcctcacgcatgattgag
tgcctcaggaacaatttcatctatgggtcacatctaagtaaagatgaaatcgccttctct
gaccccacaccagacggcaaactctttgcaacacattactgtggaacctctcagtttttg
gtctacaactttgtcagcggcaaacgctcaacctga

DBGET integrated database retrieval system