KEGG   Danio rerio (zebrafish): 100333514Help
Entry
100333514         CDS       T01004                                 

Gene name
si:dkeyp-92c9.4
Definition
(RefSeq) mucin-1-like
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: SEA Shisa TMEM52 Prominin Rhabdo_glycop FAM163 EphA2_TM TMEM154 Herpes_gE PRIMA1 RCR SieB MLANA Tweety PAG MAP17
Motif
Other DBs
NCBI-GeneID: 100333514
NCBI-ProteinID: XP_003200649
ZFIN: ZDB-GENE-141216-314
Ensembl: ENSDARG00000098950
Vega: OTTDARG00000042275
UniProt: A0A0R4IZ38
Position
19
AA seq 288 aa AA seqDB search
MKFSFFRMKVIGLHYTGAALCFLLFSATGAQNLSILNIIQGLQSEAQVYPTPLYSFSLCM
EINNRIFNDSLLNTASLYYKNMYTEVTNVLDMAFNCPTCSTKDSYRGVNSMHFSKGSVIA
NCTIQFQTIFINNVVIKHLFLNAIENKTLPNGMIINGQYTNETVTPKWLFQPSTTTSGSA
SFYSGSGTFWLPGWAIALLVLACICIVLLIIILVLICCCWCCRRKEKKEETPTPTTVTPY
ERTSFKEHLANPTYMSHTPERNPNYPTFGEPGIQHGNQNGIYMMNPQR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcagtttcttcaggatgaaggtcattggattgcattacactggagcagcattg
tgctttctgcttttttctgcaacaggtgcccagaacctgagcatcttgaacatcatccag
gggcttcagtcagaagctcaggtttaccccacaccgctctactccttttccctttgcatg
gagatcaacaaccgcatcttcaatgactcgctcctcaacacggcctcactgtactacaag
aacatgtacacagaagtgactaatgttttggacatggctttcaactgccccacctgttct
acaaaagacagctacagaggagtgaatagtatgcatttcagtaaggggtctgtgattgca
aattgtaccatccagttccagacaatttttataaataatgttgtcatcaagcatttgttc
ctgaacgccatagaaaataagactctaccaaatggtatgatcatcaacggacaatacacc
aatgaaactgtcacacctaaatggctatttcaaccatccacaactacttcgggttcagca
agtttctactcaggaagtggcactttttggcttcctggttgggccattgcattgctagtg
ttagcatgcatctgcatagtgcttctcatcatcatcttagttctgatatgctgttgttgg
tgttgtaggagaaaagagaaaaaggaagaaacaccaacaccaacaactgtaacaccttat
gagagaacatcattcaaagagcatcttgctaatcccacatacatgtcacacacacctgag
aggaacccaaactacccgacttttggagaaccaggcattcaacatggcaaccaaaatggg
atctacatgatgaacccacagagatga

DBGET integrated database retrieval system