KEGG   Danio rerio (zebrafish): 100333801Help
Entry
100333801         CDS       T01004                                 

Definition
(RefSeq) myotubularin-related protein 3-like
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04070  Phosphatidylinositol signaling system
dre04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100333801
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    100333801
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100333801
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    100333801
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100333801
    3.1.3.64  phosphatidylinositol-3-phosphatase
     100333801
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     100333801
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    100333801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE DSPc Y_phosphatase Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 100333801
NCBI-ProteinID: XP_005171779
Position
5
AA seq 955 aa AA seqDB search
MVEEVQQSLEAHGSSGLQVEQVPFALLLGECVDHVEKTQECVLALTSYRLHIKLQENSIS
VPLQLIESVESHEPTQIQLTCKDCKVIRCNFLSVDQCQDWLRRISAASGPPARLQELFAF
SFLSCSNSVTAEDREVHDGICRAGGHKQRFKRELQRMGFDTHSAWRISNINSNYRVCSSY
PEQILVPAAVTDQQLENVAAFRSWKRIPAVVYRHQSSGAVIGRCGQPEVSWWGWRNADDE
HLVQAIAKACATDPAANTALANGSCVHNHANGTISGSDPHMANGKVEAEPSATPSQKLLI
MDARSYAAAVANRAKGGGCECPEYYPNCEVMFMGMANIHSIRKSFQCLRTLCAQVPDPLN
WLSALEGTKWLQHLSLLLKASVLVVNAVDRDHRPVLVHCSDGWDRTPQILALSKLMLDPF
YRTIEGFEVLVETEWLDFGHKFSERCGHGERADDVNERCPVFLQWLDCVHQLQRQFPCSF
QFNEAFLVKLVQHTYSCLFGTFLCNSVKEREEQRVQEKTCSVWSLLRPANQSFHNILYSP
RSETVLRPVCHVRNLMLWSAVYLHNSAPSTPSDESCVPQSTPSASPIDTPVSRLPKTRSY
ENLSTSCENLTPNRRSSDPSVKEKWQDHLLALKINGENTHTSPLQHTLALNTTAAHTQKT
LELSVTDSQIENTEQEVTEELNRKLELLCSTSVSQDSSLNMKNNDQIFPEDISHIDTTSA
DGLHHKITHNPSQSSSQSSMESDSSSNHTAQKNPFHSPSQMSAAGDVSPPSGVWRCSAAF
GPLERDGLSVHSDAVQVRLQQMETGHQLQVETLKKQVQELWSRIHANGKLSSLPDGDNNT
ESECLQRSGATDLTESSAEHIQQKDTEVSQWFSDQSSRCYGCERRFWQAARRHHCRNCGN
VFCTSCCDQKVASQQLREHKHMCQVCLSHLRPSPVPPALPPADLELEKPITASSN
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagaggtgcagcagagtttggaggctcatgggagctctggactgcaggtcgaa
caggtcccatttgcgctgctgctcggtgagtgtgtggatcatgtggagaaaacacaggag
tgtgtccttgccttaaccagctaccgccttcacatcaaactgcaggagaacagcatcagt
gttcctctgcagctgattgagagtgtggagagtcatgaaccgacgcagattcaactcacc
tgtaaagactgtaaagtcatcaggtgtaacttcctgtctgtggatcagtgtcaggattgg
ctgcggaggatcagtgcagcgtctggaccgccggctcgtctgcaggaactcttcgctttc
agcttcctgtcctgcagcaacagtgtgactgcagaggacagagaggtgcatgatgggata
tgcagagcaggaggacacaagcagaggtttaagcgagagctgcaaaggatgggcttcgac
acacacagtgcctggagaatctccaacatcaacagcaactacagggtttgttccagttac
ccggagcagatcttggtgccggctgcagtcactgatcaacagctggagaatgtggcggca
ttcagatcatggaagaggatcccggccgtcgtttacaggcaccagagttcgggcgctgtg
attggtcgatgcgggcagccagaggtcagctggtggggctggagaaacgctgatgatgag
catctggtacaagccattgctaaagcctgcgctacagatccggcagcaaacacagcactt
gctaacggctcctgtgttcacaatcatgctaacggcaccatcagtggctccgatcctcac
atggccaatggaaaggtagaggcggagccaagtgccacgccctctcagaagctgttaata
atggacgcacgctcatacgccgcagcagtagccaatcgggctaaaggaggaggctgtgag
tgtccagagtattatcccaactgtgaggtgatgttcatgggaatggccaacatccactcc
atcaggaagagcttccagtgtttgcggacgctctgcgctcaggtcccggatccactaaat
tggctgtcggcgctggagggcacaaagtggctgcagcatctgtctctgctgctgaaagcg
tctgtgctggtggtgaacgcagtggatagagaccatcggcccgtgctggtgcactgctct
gacggatgggacagaacaccacagatcctggctctgtccaaactcatgctggaccccttc
tacaggactatagagggtttcgaggtgctggtggagacggagtggctggatttcggtcat
aagttttcagagcgctgtggtcacggtgagcgtgcagacgatgtgaacgagcgctgcccg
gtgttcctgcagtggctggactgcgttcatcagctccagagacagttcccatgctcattc
cagttcaacgaggcctttctggtgaagctggtgcagcacacatactcctgtctgttcggg
acgttcctgtgtaacagtgtgaaggagcgagaggagcagcgcgtacaggagaaaacctgc
tctgtttggtctctgctgcggcctgccaatcagtccttccacaacatcctctactctcca
cgctcagagacggtcttgcgtcctgtttgtcacgtgaggaatctgatgttatggagtgct
gtgtatttgcataactccgccccttccacaccctccgatgagtcatgtgtgccacagtcc
actccctcagcctcacccatagacacacctgtgagcaggttaccaaagactcgatcctat
gaaaacctgtccacatcgtgtgagaatctgaccccgaaccgccgcagcagtgaccccagt
gtgaaggagaagtggcaggatcacctgctggccttgaagattaacggagaaaacacacac
acatcacctctgcaacacacactcgccttaaacaccacagcagcacacacacaaaaaacc
ctggagctttctgtgactgacagccaaatagaaaacacagaacaggaagtgacagaagag
ctaaataggaagctggagcttctgtgcagcacatccgtttcacaggattcatcattaaat
atgaaaaacaatgaccaaatatttcctgaggacatttcacacatagacactacatcagca
gatggattacatcacaaaattacccataatccttcacaatccagcagccaatcttccatg
gaaagcgattccagttcaaaccacacagctcagaagaatccttttcactcgccctctcag
atgtcagcagcgggagacgtttctcctccatcaggtgtttggaggtgttctgcagcgttc
gggcccctggagagggatggtttgagtgttcacagtgatgcggtacaggtgcgtctgcag
cagatggagacggggcaccagctgcaggtggagacgctgaagaagcaggtgcaggagctc
tggagccggatacacgccaacggaaaactgtcatctctgccggacggagataataacacc
gagtcggagtgcttgcagcgcagcggagccacagacctcactgaatccagcgctgaacac
atccagcagaaggacacagaggtgtcgcagtggttctcggatcagtcgtcccgctgttat
gggtgcgagaggagattctggcaggcggcacggaggcatcactgcaggaattgtgggaat
gttttctgcaccagctgctgtgaccagaaggtggcgagccagcagctccgggagcacaaa
cacatgtgtcaggtgtgtttgtctcacctgcggccttcgcctgttcctccagcgcttcct
cctgcagacctggagctggagaaacccatcaccgccagctccaactga

DBGET integrated database retrieval system