KEGG   Danio rerio (zebrafish): 100334750Help
Entry
100334750         CDS       T01004                                 

Gene name
bcl10
Definition
(RefSeq) B-cell lymphoma/leukemia 10 isoform X1
  KO
K07368  B-cell CLL/lymphoma 10
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100334750 (bcl10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD CARD_2 PSII_BNR
Motif
Other DBs
NCBI-GeneID: 100334750
NCBI-ProteinID: XP_002660738
ZFIN: ZDB-GENE-100219-2
Ensembl: ENSDARG00000077130
Vega: OTTDARG00000040917
UniProt: E7F8A6
Position
2
AA seq 241 aa AA seqDB search
MDVTHLTEDEMADIKKEAIERLRPYLVDKIIADRHFDYLRSKKILTREDTEEISCRTTRG
KRTSKLLDILAENPRGLDMLIESIKWGRTLNFIIARITDEVQRVKNERLEALKAGSNSAY
PTTKGATNDFSKMDSDYDKYSTMCLHPEGEASSSSSVATGSFNLRYSSTRGNEALMVSGG
SGTMNVSSTSSILPKPGDPGAPALPEEMENDEQDMDGGVCKSAGSSGDANFQPLRSRSLS
P
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggatgttactcacctgacggaggacgaaatggccgatataaagaaggaagccatagaa
aggttgcgaccgtacctggtggataagatcatcgccgaccgtcactttgattatctgcgc
tcgaagaagatcctgaccagggaagacacggaggagatcagctgcaggaccaccagaggg
aaacgcaccagcaaactgctggacatcctggcagaaaaccctcgcggcctggacatgctc
atcgagtccatcaaatggggccgaacgctcaactttatcatcgccaggatcacagacgag
gtgcagcgggtcaaaaacgagcgcctggaggctttaaaagcggggtccaactcggcttac
ccgaccacaaaaggagcaaccaatgacttctccaaaatggactcggactatgataaatac
tccactatgtgtttacatcctgaaggcgaagccagttcctcgtcctctgtggcgacggga
tcctttaacctgcgctacagctccactcgggggaacgaggctctaatggtgagtggaggt
tcgggtactatgaacgtctccagcacatcatcgatccttcctaaaccaggagaccccgga
gctccagccctgcccgaggagatggaaaacgacgagcaagacatggacggcggcgtatgt
aaaagtgctggaagtagcggagatgctaacttccagccgctacgatcgcgctctttgtct
ccgtaa

DBGET integrated database retrieval system