KEGG   Danio rerio (zebrafish): 100334933
Entry
100334933         CDS       T01004                                 

Gene name
si:ch73-36p18.2
Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    100334933 (si:ch73-36p18.2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    100334933 (si:ch73-36p18.2)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    100334933 (si:ch73-36p18.2)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100334933 (si:ch73-36p18.2)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 100334933
NCBI-ProteinID: XP_002666951
ZFIN: ZDB-GENE-131127-56
Ensembl: ENSDARG00000114370
Vega: OTTDARG00000039540
UniProt: Q4QRF4
Position
25
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcaagaaccaagcagaccgcccgtaagtccactggaggcaaagctccgaggaagcag
ctcgccaccaaagcagcccggaagagcgctccagccaccggtggcgtcaagaaacctcat
cgctacaggcccggcaccgtggctctgcgagaaatccgccgttatcagaagtccactgag
ctgctgatccgcaaactgccctttcagcgcctggtccgagaaatcgcccaggacttcaag
acagatctgcgcttccagagctccgctgtcatggctctgcaggaggccagcgaggcttat
ctggtcggtctgttcgaggacaccaatctgtgcgccatccacgccaagagggtcaccatc
atgcccaaggacatccagctagcccgccgcatccgtggagagcgcgcttaa

DBGET integrated database retrieval system