KEGG   Danio rerio (zebrafish): 100536492
Entry
100536492         CDS       T01004                                 

Gene name
mhc1lla
Definition
(RefSeq) major histocompatibility complex class I LLA precursor
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: C1-set TMEM154
Other DBs
NCBI-GeneID: 100536492
NCBI-ProteinID: NP_001314818
ZFIN: ZDB-GENE-140820-13
Ensembl: ENSDARG00000096977
UniProt: A0A0G2KIH5
Position
25
AA seq 346 aa
MTGKVLFVLFLLSAPTTVLTDSHSLWLLGTYIKGETQFPKLSFTVMLDDLRVGFYNSETK
EFIPRDNTTNEDEAVSDVLTVIQNTLEPFMMSTLTFKNGTESPQLFQITWHCELLDNDKP
GQIIFKIAFSGSTTDEVSFYNDNFTCQCQNNMATVPLESFQMHYETVCYPNCIATIRDYL
KKRQTQVNGKVQPKVRLIKKVHPKSGGFRLSCLATEFYPHSINLTLLRDGQPVSDHEVTG
GNLLPNGDGTYQMRKSLEIRADEREKHKYTCSVSHLSLDKILDIDFEFDPSFLIKIVIPV
VVLLSLMLVLTAVLIHKCKNKRAESKETITTASTPEPTEMSETLRK
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgactggcaaagtattgtttgtcctgtttctgctgtcagctccaaccactgttttaaca
gattctcactcactgtggttgcttggaacttacattaaaggagaaactcaatttcctaaa
ctaagtttcacagtcatgctagacgacttgagagtaggattctataattctgaaacaaag
gagttcattccacgggataatacgacaaatgaagatgaggctgtttctgatgtgcttact
gtaatacaaaatacgttggagccctttatgatgtcaacactaacgtttaagaacggtaca
gaaagtcctcaactttttcaaattacatggcattgtgagctgttggacaatgataagcct
ggacaaattatttttaagattgcttttagtggctcaactacagatgaagtgagtttttat
aatgacaactttacatgtcaatgccaaaacaacatggcaactgtaccgttggagtctttc
cagatgcattatgagaccgtatgttatccaaactgcatagcaaccatcagagattattta
aaaaaaagacaaactcaagtaaatggaaaagtacaaccgaaagttagactaattaagaaa
gtacacccaaaatctggagggtttcgcttgagttgtttggcgacagaattttacccccat
tccatcaacctgaccctgttaagggatggacagcctgtatctgatcatgaggtcactgga
ggaaatctgctgcccaatggagacgggacgtaccagatgaggaagagtctggagatcaga
gcagatgagagagaaaaacacaaatacacctgctctgtctcacaccttagtctggacaaa
atccttgatattgattttgaatttgaccccagtttcctaattaaaatagtgattcctgta
gtggtgcttctgtctctgatgttggtgcttacagctgtcctcatacacaaatgcaagaat
aaacgagcagaatccaaagaaaccatcaccacagcatcaacacctgaacctaccgagatg
agtgaaacattaaggaaatga

DBGET integrated database retrieval system