KEGG   Danio rerio (zebrafish): 100861448
Entry
100861448         CDS       T01004                                 

Gene name
or80a11
Definition
(RefSeq) odorant receptor 106-9
  KO
K04257  olfactory receptor
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    100861448 (or80a11)
G protein-coupled receptors [BR:dre04030]
 Others
  Chemoreception
   Olfactory
    100861448 (or80a11)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 100861448
NCBI-ProteinID: NP_001243272
ZFIN: ZDB-GENE-070806-61
Ensembl: ENSDARG00000102933
Vega: OTTDARG00000042416
UniProt: Q2PRK8
Position
10
AA seq 313 aa
MVNETFVKNVDSFIITGFDHLQNQKLLGSLILISYMFILLGNGINLCIISTDRHLHKPMY
ILICNLAVVDIMYSSTCSTTMISVLLAEIKTVSYYSCISRTYFFNLGDLTECMALTLMAL
DRLIAISLPLRYHSFVTNSRILWLIFLTWILSFALIGFLTYVADTLPYCQPIIKYVFCSY
SSLVRAACVDPEPYFAISTVYSMVTLCGPFPFILCTYAVLAYSVTKLANSSRKQMINTCL
SHIIVLFSFYLPKIVYILLTKIGVVLTLTERNAVLIVSCFVSLLVNPTVYCIRTKEIRRK
ITDIFLYTQKITK
NT seq 942 nt   +upstreamnt  +downstreamnt
atggtgaatgaaacttttgtgaaaaatgttgacagctttataattactggatttgatcac
ctgcagaaccaaaagcttcttggatcgctcatcttgatatcctacatgttcatattactt
gggaatggcatcaatctgtgtatcatctcgactgacagacatttacacaaaccaatgtac
atattaatctgtaatctagctgttgttgacataatgtactcctcgacttgcagcacaacc
atgatctcagtgctgctggctgagattaaaacggtttcatactactcttgcatctccagg
acatatttctttaatcttggagatttaacagagtgcatggctctgacattaatggcatta
gacagacttattgccattagtcttcctttaaggtatcacagctttgtaacaaactcacga
atattatggcttatttttctaacctggatattaagttttgctttaataggttttttgaca
tatgtggcagacactcttccatactgtcagcctatcatcaaatacgtgttctgtagttat
tcttctctggtccgagctgcctgtgttgatcctgaaccctattttgctatttctacagta
tatagtatggtgacattgtgtggacctttcccttttattctgtgcacgtatgctgttcta
gcatatagtgtgactaaactggccaactcaagcagaaagcaaatgatcaacacttgctta
agtcatataattgtcctgttcagtttttatctacctaagatcgtctatattttactaact
aaaataggagttgtgttgactttaactgagagaaatgccgttttaattgtatcctgcttt
gtttctcttttagtaaaccccactgtttattgcatcaggactaaagaaatcagaagaaaa
ataacagatatattcttgtacacacaaaaaataaccaagtaa

DBGET integrated database retrieval system