KEGG   Danio rerio (zebrafish): 101884775
Entry
101884775         CDS       T01004                                 

Definition
(RefSeq) Schwann cell myelin protein-like
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Ig_3 Ig_2 C2-set_2 I-set ig V-set TMEM51 TMEM154 FAM176 SURF6 DUF4834 zf-CGNR EphA2_TM
Other DBs
NCBI-GeneID: 101884775
NCBI-ProteinID: XP_009298710
Ensembl: ENSDARG00000090038
UniProt: F1QLD8
Position
4
AA seq 509 aa
MDTTQKIIIFCFLLQGVCCRDFNISLPEKIQALSGSCVVIKCRFEINETYDKDLTERAAG
VWYKDTHDKSSSPVFNSSASTQNSFIKGNITGQLNYKDCTTVFYDVTSNHSGQYFFRIEG
EGGLKWTFTKSNTSVVVIESPVNPQVVLYVNEQELQDQQEVLEGRSVSLRCSADDLCSSP
PATLTWSSTARIPHSESSKLQELIISDLNFTAAQRHHRVTFTCSISYQLQDNNKTAHSSI
TLHVQYAPQILNSSCNIGNVNVCFCEVDGNPSPVVEWHLSGRLVSNSSNMFISEERLSNT
SLRSFISLDQSLTQTSTLLCVSKNTHGNESLQLLPSSTRLSFSFMLIGVAVVLLVTLISV
IIYLRKERGKLQQTKQEESAKGSGQNADKENEGDSLYATVSSVEDATANPDIHRQKSIIY
SSIDFKNYKAESEEVESVSCLHADYAVVQRDSGGAAEAESLVREFSRSTEAQVIERADKL
TKQTPLKQSEEELFGVDSQLYEKITYHSP
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggacactactcagaaaatcattatcttctgttttctcttgcaaggtgtttgctgtaga
gatttcaacatcagtttgccagagaagattcaagctctcagtggatcctgtgtggttata
aagtgcagatttgagattaatgaaacatatgataaagacctcactgagagagctgctgga
gtctggtataaagacacacatgataagagcagcagcccagtgtttaactctagtgcatca
acccagaactcttttattaaagggaatataactggacaattaaattacaaggactgtacc
actgtcttttatgatgtcacatcaaatcatagtggtcagtatttcttccggattgagggt
gaaggtggactgaaatggacctttacaaaaagcaatacttcagtagttgtgatcgagtct
ccagtgaatcctcaagttgtgctatatgtgaatgagcaggaactgcaggatcagcaggag
gtgttggagggcagatctgtgagtctgcgctgctctgctgacgatctctgctcttctcct
ccagcaactctcacatggagctccactgccagaatcccccacagtgagagcagcaaacta
caggagctcatcatctctgatctgaacttcactgctgctcagcggcaccacagagtcact
ttcacctgctctataagctaccagctgcaggacaacaacaaaacagctcacagcagcatc
acattacatgtgcagtatgctcctcagatcttaaactccagctgtaacattgggaatgta
aatgtgtgtttctgtgaggttgatgggaatccctctcctgtagtggagtggcatctgtct
ggacgtctcgtctcaaactcctcgaacatgttcatcagtgaagagcgattgagtaacaca
agcttgaggagcttcatctctctagatcagtctctcacacagacaagcactctgctgtgt
gtcagtaaaaacactcatggtaatgaaagtcttcagcttcttccatcttcaacacgtttg
agtttttccttcatgctgattggagttgctgttgtgcttttggtgactttgatatcggtc
attatatatctacgaaaagagcgtgggaaacttcaacaaaccaaacaagaagaaagtgct
aaaggaagtggtcaaaatgcagataaagagaatgaaggagactctctttatgccactgtg
tcatctgttgaagacgccacagcaaatccagacatccatcgccaaaaatccatcatttat
tcctccattgacttcaaaaactataaagcagagtcagaagaggtggagagcgtctcttgt
cttcatgctgactatgcagtggtccagcgtgattctggaggagcagcagaagcagagagt
ttagtgagagagttttcaagatcaacagaagcacaggtgattgagagagcagataaactt
actaaacaaacaccgttaaagcaatcagaggaagagctctttggagtagactctcagctt
tatgaaaagattacatatcatagtccttag

DBGET integrated database retrieval system