KEGG   Danio rerio (zebrafish): 103908641
Entry
103908641         CDS       T01004                                 

Symbol
si:zfos-367g9.1
Name
(RefSeq) mamu class II histocompatibility antigen, DR alpha chain-like
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: C1-set MHC_II_alpha Ig_3 Ig_2 ig C2-set_2 I-set
Other DBs
NCBI-GeneID: 103908641
NCBI-ProteinID: XP_005167290
ZFIN: ZDB-GENE-091204-401
Ensembl: ENSDARG00000074816
Vega: OTTDARG00000032579
UniProt: F1QNN0
Position
8:36354163..36362766
AA seq 236 aa
MELHIIILSLAIVLSTGTEFEHEVNQIQVCSNTEQEFFIGYDGEEIWHADIAHRRGVKTT
PSFAQYAVIPDIYERALAFLDFCKYDLHAYIKYFNNPPPEMDAPQTSIYSKGNVQLGIQN
TLVCHVTGFYPPFVNISWTKNNVIVTEGMSLSQYHPRVDGTFNIFSTLKYTPAEGDIYSC
TVNHRTLQGQPQTRIWDVDVVLPNFGPSVFCGVGLTIGLLSVAIETFFLFKRKKSN
NT seq 711 nt   +upstreamnt  +downstreamnt
atggagctgcatataattattctctctctagccattgttctctctactggtactgaattt
gaacatgaagtaaaccagattcaagtatgttccaatacagaacaagagttttttattgga
tatgatggagaggaaatatggcatgctgacattgcacataggagaggagtcaagacaaca
cccagttttgcacaatatgcagtaatccctgatatttatgaacgtgcccttgctttttta
gatttttgcaaatacgatttgcatgcctatatcaaatatttcaacaacccaccaccagaa
atggatgcaccgcagacgtccatctattcaaagggtaatgtacagctgggaattcagaac
acccttgtctgtcatgtgactggcttctatcctccgtttgtcaacatctcatggactaag
aataatgttattgtgacagagggtatgagtttaagtcagtaccatccaagggtagatggc
actttcaacattttctccactcttaagtacacacctgctgaaggagacatttacagctgt
acagtgaatcacagaactcttcagggccaacctcagaccagaatatgggatgttgatgtt
gtcctcccaaactttggtccatcagtgttctgtggagtgggtctgactattggactcttg
agtgtcgctatcgaaactttctttctttttaaaagaaaaaagagcaactga

DBGET integrated database retrieval system