KEGG   Danio rerio (zebrafish): 103908689
Entry
103908689         CDS       T01004                                 

Gene name
si:dkey-182i3.9
Definition
(RefSeq) zinc finger protein 345-like
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-met zf-C2H2_jaz Zn-ribbon_8 zf-AN1
Other DBs
NCBI-GeneID: 103908689
NCBI-ProteinID: XP_009290015
ZFIN: ZDB-GENE-121214-310
Ensembl: ENSDARG00000096575
Vega: OTTDARG00000039999
UniProt: R4GEK1
Position
15
AA seq 670 aa
MVEYDLFHQQIVSIMALLSETAREEIQKVFDYECHLSHTHICCDRDEFLELNEKQRRVAK
LTAVMETFSKVAIQKICKVFSCCLALQQTLLRDVKSYSGNVVKVKALKKKHLEKAERNCN
QIVKDVPAVAPSLFPTQQNLLTLLPEENKQPQESVEGHQSEEKTHISEFFPDSSSAAKEK
TMQAFLIEVEYSAVTSGEDQQTEVNTQAEQITTKSKTTKEPVSFDCNDCGKTFRWRHSLK
HHKCGLSKGPHICERCGKKFKFVTGLQKHLQNHKEKKGTCKTCGKSFADLKMHERVHLEV
KPFLCSICGRGFTVKGTLMEHQRIHTGEKPYSCETCGKQFAQTQNLTNHLLVHKTEKPWK
CSLCDKTFKSKHNMKLHQIVHTGEKSHICHICGQKFGHGTNLKRHLLLHSGVKRYGCEIC
SKRFYQSIALKRHMAIHGAPKPFMCDICGKSFVFNFALQKHLLTHRNKTNGKSGTGKTFP
CDMCEKSYSTNALLKMHQRLHSEKDPYMCKVCGKSYVSVYSLRIHERLHLGVSMWKCDVC
SKSFCNKYGLKLHQVVHTKEKPYECSVCGKTYGQPHSLKTHIRIHSGEKPHKCKTCGMSF
RLPGNLSRHKRIHTGERPFSCEVCGKRFVQHNHVKAHMQIHTGVKPFTCQKCGKKYAYRR
NYNDHKCVPL
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggtggagtatgacttatttcaccaacaaatagtgtctataatggcactgctgtcagaa
actgctcgagaagaaattcaaaaagtttttgactatgaatgtcatctttcccacactcat
atatgttgtgacagagacgagtttttggaattgaatgagaaacaacgcagagtggcaaag
ctcaccgcggtgatggagaccttttccaaggtggctattcaaaaaatatgtaaagttttc
agttgttgcttggcacttcagcagactctactgagagatgtaaaaagttacagtggaaat
gttgtaaaagttaaagcactcaagaagaagcatttggaaaaagcagaaagaaattgtaat
caaattgtcaaagatgtacctgctgtagctccatcattgtttccaacacagcaaaatttg
ctcactttgttacctgaagaaaataaacaaccacaagaatctgttgaaggccatcagtct
gaagagaagactcacatttctgaattttttcctgattcgtcaagtgctgctaaagaaaaa
acaatgcaagcatttctaatagaagttgaatactctgctgttacatctggagaagaccag
caaactgaagtaaacacacaagcagagcaaatcaccacaaagtccaagacaactaaagag
ccagtatcatttgactgtaatgactgcggaaagacatttcgctggagacactcactaaag
catcacaaatgtggactttcaaaaggacctcacatatgtgaacggtgcggaaagaagttt
aaatttgtaacaggattacagaaacacctacaaaatcacaaagagaagaagggaacctgt
aaaacttgtgggaaaagctttgcagatcttaaaatgcatgaacgtgtccacctggaggtg
aagccttttctttgttccatatgtggacgcggctttactgtaaaggggactttaatggag
caccagcggattcatactggtgaaaaaccatacagctgtgagacttgcgggaagcagttt
gcacaaacacaaaacctcaccaaccatctgttggttcataagacagaaaaaccatggaag
tgcagcctctgtgacaagacttttaaatcaaaacataatatgaagttgcaccagattgtg
catacaggagagaagtcccatatttgtcatatttgcggacagaagtttggacacggtaca
aatctcaaaaggcatctgcttttgcacagtggtgtgaaacggtacggctgtgaaatttgt
tccaagcggttttatcagagtatagctttaaagagacacatggcaatacatggagctccg
aagccattcatgtgtgacatatgtgggaagagcttcgtgtttaactttgctttacagaag
catttactcacacacagaaataaaacaaatggtaaatctggaactgggaagacttttcca
tgtgatatgtgcgagaaaagctacagtaccaacgctctgctcaaaatgcatcagagactc
cattcggaaaaggatccttatatgtgtaaagtctgtggtaaaagctacgtcagcgtgtat
tcattaagaatacatgagagattacatttgggggtgtcaatgtggaaatgtgacgtgtgc
agtaagagtttttgtaacaaatatgggttgaaactccaccaggttgttcatactaaagag
aaaccctatgaatgttctgtttgcggcaaaacatatggacagccgcacagtcttaaaacg
catatccgcatacactctggtgaaaagccacataagtgcaaaacgtgcggaatgagcttt
cggttgcctggaaatttaagccgtcacaagcggatccacactggcgaaaggccgttcagc
tgcgaggtctgtgggaaacggtttgtacaacacaaccatgtgaaggcacatatgcaaatc
cacactggtgtgaaaccattcacgtgccaaaaatgcgggaagaaatatgcataccgtaga
aattataatgatcacaaatgtgtgcctctgtga

DBGET integrated database retrieval system