KEGG   Danio rerio (zebrafish): 108181672
Entry
108181672         CDS       T01004                                 

Definition
(RefSeq) major histocompatibility complex class I-related gene protein-like
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: C1-set Gp-FAR-1 Psg1 MAP17 MHC_I Herpes_gE
Other DBs
NCBI-GeneID: 108181672
NCBI-ProteinID: XP_017209800
Ensembl: ENSDARG00000051710
UniProt: A0A0G2KL77
Position
25
AA seq 365 aa
MQCKFTDSLVLIFSLVFPLASYGYSPPVSGSHSIRMFATYIKGKTPFPELSGVVMLDDIR
VLYYNGVTDSFLARGNTTAEDDVFDPDDLENIKGFIKSEFSFLNAQNTFTKTDGIFVSQI
LAMCELKDDGEPGQMIGQDAFERLTIFTVLYADNKCTIDINLNISQEQKEKIIEGVKNYY
RNLIQPFCYKTLKVYLKKRKDQVNRKVEPKVRIFHKANLDFGGFRVSCLATGFYPRHINL
TLLRDGQPVSDHEFTGGDLLPNGDGTYQMRKSLEIRAEDSEKHKYTCSFKHLDKEWHIDL
AEPHRNTIWIAVSVLLVCAIIVGLAMLIWKRYQTARQRENEPNNHQTTHMNAPEDVDLMD
HSRVE
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgcagtgcaaatttacagactcgttagtcctcattttttcgcttgtatttccacttgcg
tcgtatggttattctcctcctgtttctggctctcactccataaggatgtttgcaacgtac
attaaaggaaaaacgccatttcctgaattaagtggtgtagttatgctggatgatatcaga
gttctgtactataatggtgttacagatagtttcttagcaagaggaaacacaacagctgaa
gatgatgtgtttgatccagacgatctcgaaaatattaaagggtttataaaatcagagttt
agttttttaaatgcacaaaacacctttactaaaactgatggtatttttgtctctcaaatt
ctggcaatgtgtgagctaaaggatgatggtgaaccaggacaaatgattggacaagatgct
ttcgaaagattaaccatatttacggtgctatatgctgacaataaatgtaccatcgacatc
aacttaaacatctcacaggaacaaaaagaaaaaattattgaaggagtcaaaaactattat
agaaatctaatccaaccattctgctataagacactcaaggtttaccttaagaaaaggaag
gatcaagtcaatagaaaagtggaaccaaaagtcagaatatttcacaaagcaaacttggac
tttggaggttttcgtgtgagctgtttggcgacaggattttaccctcgtcacatcaacctg
accttgttaagagatggacagcctgtatctgatcatgagttcactggaggagatctgctg
cccaatggagacgggacgtaccagatgagaaagagtctggagatcagagcagaggacagt
gaaaaacacaaatacacctgctcttttaaacacctggacaaagaatggcacattgatttg
gctgaacctcacagaaacaccatatggatcgctgtttctgtcctgttggtatgtgctata
attgttggtttggcaatgcttatttggaagagataccaaacagcaagacagagagaaaat
gaaccaaataaccaccaaactacacatatgaatgcacctgaagatgtggatctgatggat
cactccagggtggagtaa

DBGET integrated database retrieval system