KEGG   Danio rerio (zebrafish): 114401Help
Entry
114401            CDS       T01004                                 

Gene name
bcl2l1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04115  p53 signaling pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04210  Apoptosis
dre04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    114401 (bcl2l1)
   04137 Mitophagy - animal
    114401 (bcl2l1)
  Cell growth and death
   04210 Apoptosis
    114401 (bcl2l1)
   04115 p53 signaling pathway
    114401 (bcl2l1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    114401 (bcl2l1)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     114401 (bcl2l1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    114401 (bcl2l1)
Transporters [BR:dre02000]
 Other Transporters
  Pores ion channels [TC:1]
   114401 (bcl2l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 114401
NCBI-ProteinID: NP_571882
ZFIN: ZDB-GENE-010730-1
Ensembl: ENSDARG00000008434
Vega: OTTDARG00000028128
UniProt: Q90Z98
Position
23
AA seq 238 aa AA seqDB search
MSYYNRELVVFFIKYKLSQRNYPCNHIGLTEDTNRTDGAEENGEGAAGATTLVNGTMNRT
NASSTGTPPQSPASSPQRQTNGSGGLDAVKEALRDSANEFELRYSRAFNDLSSQLHITPA
TAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIAEWMTVYLDNH
IQPWIQSQGGWERFAEIFGKDAAAESRKSQESFKKWLFAGMTLLTGVVVGGLIAQKRL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactataaccgagaactggtggtattttttatcaaatataaactctcgcagagg
aactacccctgcaaccacattggacttacagaagacacaaatcggactgatggggctgaa
gagaatggcgagggggcagcaggagcgacaactcttgttaatggcaccatgaatagaacg
aacgctagttccactgggaccccaccacaatcccctgcttcatccccccagcgtcaaaca
aatgggtctgggggtctagacgcagtgaaggaggcgcttcgtgattctgccaacgagttt
gagctgcgctattccagagcattcaacgatctttcctcacagctccacatcacacccgcc
acagcgtaccagagcttcgagagcgtgatggatgaggtgtttcgcgacggcgtcaactgg
ggccgaatcgtggggttgttcgcattcggaggggctctgtgcgtcgagtgtgtggagaag
gagatgagtccgcttgtgggacgcatcgcagaatggatgaccgtctacctagacaaccat
attcaaccctggatccaaagccaaggaggatgggaacgctttgcagagatctttggaaaa
gatgcagcggcggaaagcaggaaatcgcaagaaagcttcaagaaatggttgtttgcagga
atgaccttgctcacgggtgtcgtcgttgggggactcattgcacagaaacgcctgtga

DBGET integrated database retrieval system