KEGG   Danio rerio (zebrafish): 114446
Entry
114446            CDS       T01004                                 
Symbol
dlg1a
Name
(RefSeq) disks large homolog 1
  KO
K12076  disks large protein 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04530  Tight junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    114446 (dlg1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    114446 (dlg1a)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    114446 (dlg1a)
SSDB
Motif
Pfam: PDZ Guanylate_kin MAGUK_N_PEST PDZ_6 PDZ_assoc L27_1 PDZ_2 Peptidase_M50 DUF6288 L27_2
Other DBs
NCBI-GeneID: 114446
NCBI-ProteinID: NP_955820
ZFIN: ZDB-GENE-010724-8
Ensembl: ENSDARG00000009677
UniProt: Q5PYH6
Position
6:29860980..30082922
AA seq 873 aa
MPVRQKDAQRALQLLEEYQTKLSQTGDPHLRLSIERVINIFKSTLFQALVDIQEYYEVSL
QDTEDKPIEDSSLKSRESFPPVNEWNLSVPPSTTGPTEPVPINLPQTEEKYRYQDEDTTS
PPEHSSPHIPGDARPPELVQVSEKNISQIENVHGYVSHSHISPMKQADVIPPPSAPIIPV
IPISPVPAETTAIIPAPASQASPAPVVVNTESLDSSPYVNGTEADYEYEEITLERGNSGL
GFSIAGGTDNPHIGEDPSIFITKIIPGGAAAQDGRLRVNDCILRVNDVDVRDVTHSNAVE
ALKEAGCIVRLYVRRRKPLSEKIMDVKLVKGPKGLGFSIAGGVGNQHIPGDNSIYITKII
EGGAAHKDGRLQIGDKLLAVNAVCLEEVTHEDAVAALKNTPDVVYLKVAKPTSVFMNDSY
APPDVTSSYSQHMENHISTQSYLSQPLTPATPSRYSPVSKGMLGDDEITREPRKIVLHRG
TTGLGFNIVGGEDGEGIFISFILAGGPADLCGELRKGDRIVSVNGVDLRSATHEQAAAAL
KNAGQTVTIIAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRTLYVRALFDY
DITKTVKFNSKSRDKASLNDKRRKTLFSRKFLFSKNKDSGEQDTSDVDQHVTSNASDSES
SFRGQEDYVLSYETVTQQEVSYSRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKR
DYEVDGRDYHFVNSREQMEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVS
GNAIKRLQLAQLYPIAVFIKPKSVENILEMNKRLMEEQGRKTYDRAMKLEQEFLEHFTAI
VQGDTLEEIYNQVKQIIEEQSGPFIWVPVKEKL
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgcctgtgagacagaaagatgctcagcgggcactgcagcttttggaggaataccaaact
aaactcagtcagactggagatcctcatctcagactgtcaatcgagagggtcataaacata
tttaagagtacacttttccaggctcttgtagacatccaggaatattatgaagtgagcctt
caggatactgaggataaacccatagaggattcaagccttaaaagcagagagtcatttcct
cctgttaatgaatggaatctcagtgtccctcccagcactactggaccaacagaaccggtg
cccatcaatcttcctcaaacagaagagaaatatagataccaggatgaggacactacgtca
cctcccgaacacagctctccacacatcccaggagatgcacgtcctcctgagttggtgcag
gtgtcggagaagaacatctcccagattgagaatgtacacggctatgtttcccattcacac
atttctccaatgaagcaggcagatgtcattcctcctccctccgctcccataatccctgtg
atcccaatctcacccgtcccggccgagaccactgccatcattcctgcacccgcgtcacag
gcaagtccagcaccggtggtggtgaacacagaaagccttgactcttcaccatatgtgaat
ggaacagaagctgattacgaatatgaagaaatcacacttgaacgggggaactcgggcctg
ggtttcagtattgcaggcggtaccgataacccccacatcggcgaggacccaagcatcttt
atcaccaagatcatcccaggaggagcagccgcacaggacggcagactcagagtgaatgac
tgtatactgcgggtgaatgatgtagatgtgagagacgtaactcacagtaatgccgtggag
gcgctgaaggaggcaggctgcattgtcagactgtacgtcagaagaagaaaacccctctca
gaaaaaatcatggatgtaaagctggtaaaaggtcctaaaggtctaggtttcagtatagca
ggaggtgttgggaaccaacatattcctggggacaacagtatttatatcaccaaaatcatt
gaaggaggagctgcccataaagatggaaggttacagattggggataaactgttggctgtg
aatgctgtttgccttgaagaggtcactcatgaagatgccgtggctgccttgaaaaacacc
cctgatgttgtctatttaaaagtggcgaaacccactagtgtctttatgaatgatagttac
gctcctcccgatgtcaccagctcctactcccagcacatggagaaccatatcagcacccaa
agctatctgagtcaaccattaacccctgccaccccatctcggtactctcctgtctcaaaa
ggcatgctgggagatgatgagatcacaagggagcctaggaaaattgtcctgcatcgggga
accacgggactaggcttcaacattgtaggaggagaggacggagagggaatcttcatctcc
ttcattttagcaggagggcctgcagacctgtgtggagaactgaggaaaggagaccgtatc
gtctctgtaaatggagtggacctccgcagtgcgacgcatgagcaggcggccgcagcactg
aagaacgctggacagacggtcactatcattgctcaatacagacctgaagagtacagtcga
tttgaagccaaaatccatgatctacgggagcagatgatgaacagcagtattagttcaggc
tccggctcattgcggacgagtcagaaaaggacgctgtatgtcagagccctgtttgattat
gacataacaaagacggtcaaattcaactctaaatctcgagacaaagcgtcactcaatgac
aagcgtagaaagaccctgttttcgcgaaaattccttttctccaagaacaaggactccggt
gagcaggacacgagcgatgtggaccagcatgtaacgtctaatgccagcgatagtgaaagt
agtttccgtggacaggaagattatgttctctcctatgagacggtcacacaacaggaagtg
agttacagtcgtccagtcatcatccttggacccatgaaagacagaatcaacgatgatctc
atctccgagtttccagacaaatttggatcatgtgttccccacacaactagaccaaagcgg
gactacgaggtcgatggcagagactaccattttgtgaattcacgggagcagatggaaaaa
gacattcaggatcacaagttcatcgaggccggacagtacaacaaccacctgtacgggacg
agtgtgcagtctgtgcgagaggttgcagaaaagggcaagcactgcattctggacgtctcc
ggcaatgccattaaacggcttcagttggcacagctttaccccatagctgtgttcatcaaa
ccaaaatcagtggagaatattttagagatgaataagaggttgatggaggagcagggaagg
aagacttatgacagagctatgaaactggagcaggagttccttgagcacttcaccgccatt
gttcaaggggacacattagaggagatctacaaccaggtgaagcagatcatcgaggagcag
tctggacccttcatctgggttcccgtcaaagagaaattgtga

DBGET integrated database retrieval system