KEGG   Danio rerio (zebrafish): 140617
Entry
140617            CDS       T01004                                 

Gene name
rab2a
Definition
(RefSeq) ras-related protein Rab-2A
  KO
K07877  Ras-related protein Rab-2A
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    140617 (rab2a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    140617 (rab2a)
   04031 GTP-binding proteins [BR:dre04031]
    140617 (rab2a)
Membrane trafficking [BR:dre04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    140617 (rab2a)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   140617 (rab2a)
  Exosomal proteins of other body fluids (saliva and urine)
   140617 (rab2a)
  Exosomal proteins of colorectal cancer cells
   140617 (rab2a)
GTP-binding proteins [BR:dre04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    140617 (rab2a)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_22 DAP3
Other DBs
NCBI-GeneID: 140617
NCBI-ProteinID: NP_958862
ZFIN: ZDB-GENE-011212-2
Ensembl: ENSDARG00000020261
Vega: OTTDARG00000019621
UniProt: Q803J3
Position
2
AA seq 212 aa
MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGPQHAATNSTMGGSQGGQQAGGGCC
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcgtacgcgtatctcttcaagtacatcatcatcggagacacgggtgtgggaaagtcg
tgcctattattacagttcacagataagcgctttcagccggtgcacgatctcactattggt
gttgaatttggagcgcgaatgatcactatagatggcaaacagataaaacttcagatctgg
gatacggctggacaggagtccttccgctcaatcaccaggtcttactacagaggtgcagct
ggagctctgctagtttatgacatcacaagaagagacacttttaatcacttgacaacctgg
ttagaagatgctcgtcaacattccaactctaacatggtcatcatgctcatcggaaataaa
agtgatttggagtcacggagagaggtgaagaaagaggaaggagaggcctttgccagagaa
catggcttgatcttcatggagacttctgcaaagaccgcatcaaacgtagaagaggcattt
atcaacacagctaaggagatttatgaaaagatccaggagggagtctttgatataaacaac
gaggctaacggcattaagattggaccccagcatgctgccaccaactccacgatgggcggc
agtcagggaggacagcaagccggagggggctgttgctga

DBGET integrated database retrieval system