KEGG   Danio rerio (zebrafish): 192305Help
Entry
192305            CDS       T01004                                 

Gene name
adssl
Definition
(RefSeq) adenylosuccinate synthase, like
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre00250  Alanine, aspartate and glutamate metabolism
dre01100  Metabolic pathways
Module
dre_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    192305 (adssl)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    192305 (adssl)
Enzymes [BR:dre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     192305 (adssl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt FadA
Motif
Other DBs
NCBI-GeneID: 192305
NCBI-ProteinID: NP_775344
ZFIN: ZDB-GENE-020419-28
Ensembl: ENSDARG00000012399
Vega: OTTDARG00000021112
UniProt: Q8JGR3
Position
21
AA seq 468 aa AA seqDB search
MAADSTMSNGQETACLNGEPALKRSRDSLDSLRVPREPQNKVTVVLGAQWGDEGKGKVVD
LLAMDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGVLNKKATSFIGNGVVIHLPGLFD
EAEKNLQKGNGLQGWEERLKISDRAHIVFNFHQAVDGIQEQLRQQQAGKNLGTTKKGIGP
AYSSKAARNGLRVCDLVSDFSVFEEKFRVLAGHYQTTYPNLNIDIDAELQQLKNFAERLR
PLVTDGVYFMHKALTGPSKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGVPPS
HVGRVYGVVKAYTTRVGVGAFPTEQNNEIGDLLQSRGREFGVTTGRRRRCGWLDLVLVRY
AHMVNGFSAIALTKLDILDTLPEIKIGTAYTVDGKPLPSFPANMDVLTKVQVTYETFPGW
SCSTEGVRSFDELPTQAQSYIKFIEDFLQVPVKWVGVGKSRESMIKLF
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggacagcacaatgtctaatggtcaggaaacggcgtgtctgaacggcgaaccg
gcgctcaaacgctccagagacagtctggattcactgcgggtcccgcgggagccccagaat
aaagtgaccgtagtgctgggcgcgcagtggggcgatgaggggaaggggaaagtggtcgac
ctcttggcaatggacgccgacattgtatgcagatgccagggtggaaataacgcgggacac
actgtggtcgtggactcggtcgagtatgacttccacctgctgcccagcggagttctcaac
aaaaaggccacttcctttattggaaatggtgttgtgatacacctgccaggactctttgac
gaggcagagaagaacttgcagaagggcaatggacttcaaggatgggaggaacgactgaag
atatctgaccgggcacacattgtgttcaacttccaccaggctgttgatggcatacaggag
cagctcagacaacagcaggcaggaaaaaatttgggcacaactaagaagggtattggacct
gcatactcctccaaagcagcacgtaatggactgagagtgtgtgatctggtctccgacttc
tctgtctttgaagaaaagtttcgggtgctggctggacattatcagaccacttatcctaat
cttaacattgacattgatgctgagcttcagcagctcaagaattttgctgaaagattacgg
ccactagtgactgatggggtttatttcatgcacaaagccctcactggaccaagcaagaag
attctggtggaaggagccaatgctgctttactggatattgattttgggacctaccccttt
gtgacctcatcaaactgcactgttggaggcgtctgcacaggtcttggcgtccccccatct
catgttggccgtgtatatggagtggtgaaggcctacaccaccagggttggagtcggggca
tttcccactgagcagaacaatgaaattggagatctgctgcagagcagagggagggaattt
ggagttacaacaggcaggcggcggcgctgtgggtggctggatctggttttggttcgctat
gcccacatggttaacgggttttcagccattgcgctgactaagttggacattcttgacaca
ttgcctgaaataaagattggcacagcctacacagttgatggaaagcctcttcccagtttt
cctgcaaacatggacgtgctcacaaaggttcaggtgacttatgagacgttccctggctgg
agttgtagcactgagggagtgcgcagcttcgatgagctgcctacacaggcacaaagctac
attaaatttattgaggattttctgcaagtgccagtgaagtgggttggtgttggcaagtca
agagaaagcatgatcaagctgttttga

DBGET integrated database retrieval system