KEGG   Danio rerio (zebrafish): 246093
Entry
246093            CDS       T01004                                 

Gene name
id3
Definition
(RefSeq) DNA-binding protein inhibitor ID-3
  KO
K17694  DNA-binding protein inhibitor ID3
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    246093 (id3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    246093 (id3)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    246093 (id3)
SSDB
Motif
Pfam: HLH HBS1_N She2p
Other DBs
NCBI-GeneID: 246093
NCBI-ProteinID: NP_694499
ZFIN: ZDB-GENE-020515-1
Ensembl: ENSDARG00000054823
Vega: OTTDARG00000020388
UniProt: Q8QFX4
Position
17
AA seq 116 aa
MKAISPVRSVRSCYEAVCCISEQSLAISRCKSPSEELSDMNMNDCYSKLKELVPSIPQNK
SVSQVEILQHVIDYIFDLQIALENETDTQNTPDIFLSMKNSEMSRNFSKEDGAMCH
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaaggcgatcagtcccgttcgctctgtcagaagctgctatgaagcggtgtgctgtatc
tcggagcagagcctcgccatcagccgctgcaagagtccttccgaggagctgtccgacatg
aatatgaatgactgttactccaaactcaaagagctggtgcccagcatcccgcagaacaag
tccgtgagccaagtggagattctccaacatgtcatcgactacatcttcgacttacagata
gcgctggaaaacgagacagacacacaaaacacgcctgacattttcctgtcaatgaagaac
tcagagatgagccgtaatttctccaaagaagatggagctatgtgccattag

DBGET integrated database retrieval system