KEGG   Danio rerio (zebrafish): 259258
Entry
259258            CDS       T01004                                 

Symbol
p2rx4a
Name
(RefSeq) P2X purinoceptor 4a
  KO
K05218  P2X purinoceptor 4
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04020  Calcium signaling pathway
dre04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    259258 (p2rx4a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    259258 (p2rx4a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    259258 (p2rx4a)
Ion channels [BR:dre04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   259258 (p2rx4a)
SSDB
Motif
Pfam: P2X_receptor
Other DBs
NCBI-GeneID: 259258
NCBI-ProteinID: NP_705939
ZFIN: ZDB-GENE-020806-2
Ensembl: ENSDARG00000044752
Vega: OTTDARG00000034863
UniProt: Q98TZ0
Structure
PDB: 
5WZY 4DW1 4DW0 3H9V 3I5D

Position
21
AA seq 389 aa
MSESVGCCDSVSQCFFDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDT
DTVLSSVSTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCA
ENPTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEKIVDPPNPP
LLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTDPDCPIFRLGDIVG
EAEEDFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFA
KYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIV
LTFMKRKQHYKEQKYTYVDDFGLLHNEDK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgagcgaaagtgttggttgctgtgattcagtcagtcagtgttttttcgactactacacg
tctaaaatactgatcatcaggagcaagaaagtgggaacgctgaatcgcttcactcaagct
ttagtcatagcctacgttatcgggtatgtgtgtgtctacaacaaaggctaccaagacaca
gacaccgttctcagctcagtctcaaccaaagtgaaaggaattgctttaacaaacaccagt
gaactgggcgaaaggatctgggatgtggctgattacattattccacctcaggaggatgga
tcgttcttcgtgctgaccaacatgatcatcacaacaaaccaaacacagtccaaatgtgca
gaaaatccaactcctgcatccacgtgcacttctcacagggactgcaagagaggcttcaat
gatgctcgtggagatggtgttcggacaggcagatgtgtcagttattctgcctctgtgaag
acttgtgaggtgctgtcctggtgtcctttagaaaaaattgtcgatcccccgaacccacca
ctgcttgcagatgctgaaaacttcactgtgctcataaagaataatattcgatatcccaaa
tttaacttcaacaaaaggaacatcttaccgaatataaacagctcctacttgacacattgt
gtgtttagccgtaaaacggatcctgactgtccaatcttcagacttggagacattgttgga
gaagctgaagaggattttcagatcatggctgtccatggcggagtgatgggagttcagatc
cggtgggattgtgatcttgatatgccacagagctggtgtgtacctcgctacactttccgc
aggctagacaacaaagacccagataataatgttgctccagggtacaactttagatttgct
aaatattacaagaacagtgatggcactgagaccaggacacttatcaagggttatggcatt
cgctttgatgtcatggtatttggccaggctgggaaattcaacatcatcccaacacttctg
aatatcggtgcaggcttggcacttctaggcctggtgaacgtcatctgtgactggattgtg
ttgacatttatgaaaaggaagcaacattacaaggagcaaaagtatacatatgttgatgac
ttcggacttttacacaacgaagacaaatag

DBGET integrated database retrieval system