KEGG   Danio rerio (zebrafish): 266599
Entry
266599            CDS       T01004                                 

Gene name
id2a
Definition
(RefSeq) DNA-binding protein inhibitor ID-2a
  KO
K17693  DNA-binding protein inhibitor ID2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    266599 (id2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    266599 (id2a)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    266599 (id2a)
SSDB
Motif
Pfam: HLH
Other DBs
NCBI-GeneID: 266599
NCBI-ProteinID: NP_958448
ZFIN: ZDB-GENE-020910-1
Ensembl: ENSDARG00000055283
Vega: OTTDARG00000028615
UniProt: Q7SZQ2
Position
17
AA seq 137 aa
MKAISPVRSFRKSSASVTTTEHSLGISRSKTPVDDPLSLLYNMNDCYSKLKELVPSIPQN
KNVSKMEILQHVIDYILDLQIALDSNSAITSLHHPRAGQGTSRTPLTTLNTDISILSLQT
PEFPSDLITEDSRTLYR
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaaggcaataagcccagtgaggtccttccggaaaagtagcgcgagtgtaacgacgacg
gagcacagtctgggaatctcgcggagcaagacccccgtggacgatcctctcagcctgctc
tacaacatgaacgactgctactccaaactgaaggaactggtgccgagcatcccgcagaac
aaaaacgtgagcaaaatggaaatcctccagcatgtcatcgactatattctggacctgcag
atcgcgctcgactccaattcggcgataaccagcctgcatcacccgcgagcggggcagggg
acatccagaacacccctgacaacactcaacacagacatcagcatcctctcactacagaca
cctgagtttccatcagacttgatcacagaggacagcaggacactttaccgttaa

DBGET integrated database retrieval system