KEGG   Danio rerio (zebrafish): 266983
Entry
266983            CDS       T01004                                 
Symbol
neo1a
Name
(RefSeq) neogenin 1a isoform 2 precursor
  KO
K06766  neogenin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04350  TGF-beta signaling pathway
dre04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    266983 (neo1a)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    266983 (neo1a)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig V-set Pur_ac_phosph_N Interfer-bind C2-set_2 C1-set DUF4912 EphA2_TM
Other DBs
NCBI-GeneID: 266983
NCBI-ProteinID: NP_001315426
ZFIN: ZDB-GENE-021031-1
Ensembl: ENSDARG00000102855
UniProt: A0A0R4IIB3 A0A8M1P4Y3
Position
7:53754652..54089325
AA seq 1409 aa
MAERGARLLLSLFCLTITVSHAEKGSAVRNFSPFWFSTEPSDTLAVRGAPVLLNCSVHSE
SPAKIEWKKDGSFLSLASDERRQVLADGSLLISSVVHSKHNKPDEGVYQCVATIDNLGTI
ISRTARLNVAGIARFLSQPEMASVRVGDSQVLSCEVNPDLVSFIRWEQNKEAVELDHRVF
SLPSGALVISNATETDAGLYRCVIDNAGPTKTSEEAQLHILTETGEERTLEFLQEPQHVS
KLVGESVLLPCVVTGYPTPEITWMYKDQLIEDSSGRFEILGGGSLRIFNLTEEDAGVYNC
LAENTNGSIEAQAELTLKDSPQFLKKPVNVFAHEATDVIFECEVSGSPSPTIKWVKNGDA
VIPSDYFKIIKEQNLQVLGLVKSDEGFYQCLAENDAGNVQSSAQLVILDQGSRGGAGPTP
SAPRDVVASLVSTRFLKLTWRLPAEPHGDDVTYSVYYSLEGTNRERIVNTSRPGEMQVTI
QNLMPDTKYAFRVVAHNKNGPGESSVPLKVETQPEVQVPGPAPNLHAVVMSPSTVSLSWD
VPLIGNGEIQNYKIYYMEKGMDSEQDLDVNTLSYTMTGLKKFTEYSFRLVAYNKHGPGVS
TEDISVRTYSDVPSSPPQNMTVEVLNSKSLMIRWQPPPADAQNGEITGYKIRYRKGTRKS
EVAEITSGSQLYQLIDGLQRGTEYMLRVSAMTVNGTGPATDWTTAETFESDLDESRVPDV
PSSLHVRSLVNSIVVSWTPPENQDIVVRGYSISYGIGSPHAQTIKVDYKQRYYTIENLNP
NSHYVITLKAFNNVGEGIPVYESAITRPQSVPDPIPMLPPVGVQASVLNQDTIKVTWADN
SLPKNQKITDARYYTVRWKTNIPANTKFKVANTTTLFHTVTGLKPNTLYEFSVMVTKGRR
TSTWSMTAHGTTFESIPSSPPKDVTVVSKEGRPKTIIVNWQPPSEANGKITGYIIYYSTD
VKAEVHDWVIEPVVGNRLTHQIQELTLDTTYYFKIQARNSKGMGPMSEAVQFRTPKAESS
DKMANDQAPGISVKQGRPSAPDNGFGSPGKPDMSGTGDNHILVIVIIVSVGAFTIIVVVV
GAFLCTRRTTTQQKKKRAACKSANGSHKYKGNSKDLKPPDLWIHHERLELKPIDKSPEPN
PVMTDTPIPRTSQDITPVDGSMDPMLQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDA
QPPQPVISAHPIHSLDNHHHHYHLGSLASPTRSYLHHQSSTRSIATPISHLDRAESTESV
RNTPNAELLPPSGQPSCTTDLSETDISFHSSAAEEEPAFATPTAHVRPTHPLKSFAVPAI
PAHAMYDSAALPSTPLLSQTGPHSVKTASIGTLGRTRTPMPVIVPNAPDVSEGCRLHEDA
GSNYETDELSEEMAHLEGLMKDLNAITTA
NT seq 4230 nt   +upstreamnt  +downstreamnt
atggcggagcggggagcccggctgctcctctctcttttctgcctcacgatcacagtttca
catgctgaaaaaggatcagcagtgaggaacttcagcccattctggttctccacggagccg
tcggatacactagcggtgcgaggagcgccagttctcctcaactgctcagtccacagcgag
tctcctgccaagatcgagtggaaaaaagatggctctttcctcagcctggcttcagacgag
cgcagacaggtcctggccgatggctctctgctcatcagctcagtggtgcactccaaacac
aataaacccgatgagggggtttaccagtgcgtggctactatagacaacctgggcaccatc
attagccgtacagctagactcaacgtagcaggtatagcgcggttcctcagtcagcctgag
atggcgtcggtgcgggtgggcgacagtcaagtgttgagctgtgaagtcaacccagacctg
gtgtccttcatccgctgggaacagaataaagaggcggtggagctggaccacagagtcttc
agtctgcccagtggagctctggttatcagtaacgccacagagacagacgcgggtctgtac
cgctgtgtcatcgacaacgctggacccaccaagaccagtgaagaagcacagttgcacata
ctgacagaaacgggtgaggaaaggacgctggagtttctccaggagcctcaacatgtgtct
aaactggtcggcgaaagtgtcctgctcccctgtgtggtgacgggatatcccactcctgaa
atcacatggatgtacaaagaccagctcattgaggacagcagtggccgctttgagatactc
ggcggggggagtctgcggatcttcaatctcacagaggaggatgccggggtgtacaactgt
ctcgcagaaaacaccaatgggtccattgaggcccaggctgagctcacgctgaaggattct
ccacagttcctgaagaaacctgtgaatgtgtttgctcatgaagccacagacgtcatcttc
gagtgcgaggtctcaggatcaccttctcccaccatcaaatgggtgaaaaatggagacgcc
gtcatcccaagcgattatttcaaaatcattaaggagcagaacctgcaggtgttgggactg
gtcaagtcagatgaaggtttttatcagtgtttagctgagaatgacgctggcaacgtgcag
tcaagtgctcagctcgtcatattggatcaaggctccagaggcggcgctggccccacgccc
tccgccccccgtgatgtggtagcgtccctggtgtccacccgcttcctcaagctgacctgg
cgccttcctgctgaaccacacggagacgatgtcacctactcagtctactacagcctggag
ggcactaacagggagaggatcgtaaacaccagtcgtccaggagaaatgcaagtcaccatt
cagaacctcatgccagacaccaagtatgccttccgtgtggtggcgcacaacaaaaacggc
cctggagagagttcagtgcctctaaaggtcgaaactcagcccgaagtccaggtacctggt
ccggctccaaacctgcatgcagtggtcatgtcccccagcactgtcagtctcagctgggat
gtgcctcttataggcaatggtgagatccagaactacaagatctactacatggagaagggc
atggacagtgaacaggatctggatgtaaacacattgtcctacaccatgactggcctgaag
aagttcacggagtacagtttcagactggtggcctataacaaacatggaccgggagtctcc
actgaggacatatcagtgcgcacatactctgatgtccccagctctcctccgcagaacatg
acggtggaagtgctgaactccaagagcctcatgatcagatggcagcctccaccagccgat
gcccagaacggagagatcacaggctacaagatccgctacaggaagggtacgaggaagagc
gaggtggcggagatcacttcaggatcacagctttatcagctcatagatggtttgcagcga
ggcactgaatatatgttgcgagtatctgcaatgacggtcaacggcacaggtcctgccaca
gactggaccactgcagagacattcgaaagcgatctggacgagtcaagagtgccggacgtc
ccgagctctctgcatgttcgttctctggtcaacagtattgtggtgagctggacgcctcca
gagaaccaggacatcgtggtgaggggttacagtatcagctatgggattggcagtcctcac
gcacagaccatcaaagtggactacaagcagagatactacaccattgagaacctgaatccc
aactcgcactacgtgatcacgctgaaggccttcaacaacgtgggtgagggaatccctgtg
tacgagagcgccatcacacgaccacagtcagtaccagaccctatacccatgctgcctcct
gtgggcgttcaggcatctgtcctgaaccaagacaccatcaaagtcacctgggcggacaac
tcgctgcctaagaaccagaagatcacagatgcgcgctactatacagtgcgctggaagacc
aacatacccgcaaacacaaagtttaaggtggctaataccacgacgctatttcacacggtg
acgggtcttaaacccaataccttgtatgagttttcggttatggtgaccaagggacggagg
accagtacctggagcatgactgcacacggaacaacttttgagtcaatcccaagttctcca
ccaaaagatgtgactgtagtgagcaaagagggacgaccaaaaaccatcatcgtcaactgg
cagccgccatcagaagccaatggcaaaattacaggttacatcatttattacagcactgat
gtgaaggcagaggttcatgactgggtcattgagccagtcgtgggaaacaggctaacccat
caaattcaggagctgacccttgataccacctactactttaagatccaggctcggaactcc
aagggcatgggtcccatgtcggaagcggtccagttccgcactcctaaagctgaatcctct
gacaaaatggctaatgaccaagctccaggcatatctgtgaaacaaggaagaccttctgca
ccagataacggctttggatcacctgggaaaccagacatgtctggcactggtgataaccac
atcctggttattgtcatcattgtgtccgtgggtgcttttaccatcatcgtggtggtggtg
ggcgccttcctttgtacacgtcgtaccacaacacaacagaaaaagaaaagggccgcctgc
aagtccgccaatggatcccacaagtataagggcaactccaaagatctcaaaccaccagac
ctctggatccaccatgaacgtttggagctaaagcccatagacaaatcacccgaacccaat
ccagtcatgaccgacacaccaatccccaggacctcccaagacatcacgccggtggacggc
tccatggatcctatgctccagagacgcaactcttaccgtggccatgaatcagaggacagc
atgtctacactggcaggccgtcgggggatgagacctaaaatgatgatgccctttgatgca
caaccccctcagcctgtgattagtgctcaccccatccattccctcgataaccatcaccat
cattatcacttgggcagcctggcctcgccgacacgcagctatctccaccaccagagcagc
acgcgctccatcgccacccccatctctcatctagacagggcagagtccacagagtcagta
aggaacacccctaatgcggagctgctccctccatctgggcagccatcttgcaccactgac
ctttcagagacggacattagctttcacagctcagccgctgaggaggagccagcgttcgct
acacccacagcacacgttcgacctacacacccacttaagagttttgcagtgcctgccatc
ccggcccatgcaatgtatgactcggcagctttgcccagcactccactgctgtctcagaca
gggcctcactcagttaaaacagcctctattggtacactgggaaggacgagaactcctatg
cctgtcatagttccaaatgcgccggatgtctcagaaggctgcagacttcatgaagatgca
ggaagtaattacgagacggacgagttatcggaggaaatggcccatctcgagggcttaatg
aaggacctaaacgccatcacaacagcctga

DBGET integrated database retrieval system