KEGG   Danio rerio (zebrafish): 30114
Entry
30114             CDS       T01004                                 
Symbol
cth1
Name
(RefSeq) cysteine three histidine 1
  KO
K13056  CCCH zinc finger protein C3H-4
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    30114 (cth1)
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Other DBs
NCBI-GeneID: 30114
NCBI-ProteinID: NP_571014
ZFIN: ZDB-GENE-990806-20
Ensembl: ENSDARG00000057328
UniProt: Q9PU62
Position
7:17947328..17950308
AA seq 319 aa
MFETSQDDLFLFPTEGLNEAFFPEEGLGGGGGGLSLAEALLPLVESPSPPMTPWLCSTRY
KTELCSRYAETGTCKYAERCQFAHGLHDLHVPSRHPKYKTELCRTYHTAGYCVYGTRCLF
VHNLKEQRPIRPRRRNVPCRTFRAFGVCPFGNRCHFLHVEGGSESDGAEEEQTWQPPSQS
QEWKPRGALCRTFSAFGFCLYGTRCRFQHGLPNTIKGHNANHTSWPQQMTNGGSISPISD
TCTSPSPPSSSPTSALPSPVYPDSSGPITPPSVEAVANNAFTFSSQHLNDLLLPLALRLQ
QLEKAASAGPQDVLDKPLL
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtttgagaccagtcaagacgatctgttcctgttccccactgaaggcctgaatgaggcg
ttcttccccgaggagggtttaggtggtggtggtggtggtctatctctagctgaggccttg
cttcccttggtcgagtctccctctcccccaatgaccccttggctctgctccacccgctac
aagactgaactgtgcagccgttatgcggagacgggtacctgcaagtacgccgaacgctgc
cagtttgcccatggcctccatgatctccatgtgccctcccgtcatcccaagtacaaaacg
gagctgtgtcgtacctaccacactgctggctactgcgtttatggcacacgctgtctgttt
gtgcacaaccttaaagagcagaggcctatccgtcctcggcgcaggaacgtgccatgccgt
actttccgcgcatttggggtttgcccgtttggcaacaggtgccactttctccatgttgag
ggaggctctgaatcagatggtgctgaggaagagcaaacctggcaacctccgtcacaatcc
caagagtggaagcctcgtggtgccctctgccgcacattcagtgctttcggcttctgcctc
tatggcacccgctgccggttccagcatggacttcccaacaccatcaaaggtcacaatgcc
aaccacacgtcctggcctcagcagatgaccaacggagggtctatttcgccaatctctgac
acctgcacttcaccatctccaccttcctcgtctcctacatctgcgttgccgtctccggtc
tatcccgacagctccggtcccatcacgcctccatcagtggaagcggtggccaataatgcc
ttcaccttcagcagtcagcatctgaatgacctgctgctccctctggcccttcggctccag
cagctggagaaagctgccagtgctggtcctcaagacgtcctggataagccgctgctgtag

DBGET integrated database retrieval system