KEGG   Danio rerio (zebrafish): 30183
Entry
30183             CDS       T01004                                 
Symbol
acvr1ba
Name
(RefSeq) activin A receptor type 1Ba precursor
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04060  Cytokine-cytokine receptor interaction
dre04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    30183 (acvr1ba)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    30183 (acvr1ba)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    30183 (acvr1ba)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     30183 (acvr1ba)
Protein kinases [BR:dre01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   30183 (acvr1ba)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 30183
NCBI-ProteinID: NP_571065
ZFIN: ZDB-GENE-980526-527
Ensembl: ENSDARG00000018968
UniProt: P79689
Position
23:complement(27800519..27822921)
AA seq 505 aa
MLRDGNVAVMPPRRTAVALLALCGLLAVGDALKCNCTACESTGYVCETDGACMASTSYIN
GQEEQQVRICIPRVSLVPPGQPIYCLSAKGLLNTHCCYTDFCNSINLQIPNGIPDGKGGS
WGPVELVAVIAGPVFLFCLLLIVGVLLFQHHQRNYNHRQRLDVEDPSCDHLYLAKDKTLQ
DLIFDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTIMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNHYSVT
IEGMIKLSLSAASGLAHLHMEILGTQGKPGIAHRDLKSKNILVKKNGIFAIADLGLAVRH
ESITDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNAG
GIHEDYKLPYYDLVPSDPSIEEMRKVVCDQRLRPKWPNWWQSYEALRVMGKIMRECWYAN
GAARLTALRIKKTLSQLSVQEDIKI
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgctaagagatgggaatgttgcagtcatgcctcctcgacgaactgctgtagccttgctc
gccctgtgcggattactagcggtcggcgatgctctcaagtgtaactgcactgcttgtgag
agcacaggttatgtgtgcgagacagatggggcctgcatggcctccacatcctacatcaat
gggcaggaagagcagcaagtacggatctgcatccctcgggtcagcctggttcctcctgga
cagcccatctactgcttgagcgctaaaggcctgctcaacacgcactgctgttacacagac
ttctgcaacagcatcaacctccagattcccaatgggattcctgatggtaaaggaggtagt
tggggtccggtagagctggtggcagtgatagcaggcccggtcttcctcttttgcctgctg
cttatcgtgggagtgctccttttccagcaccaccaacgaaactataaccaccggcagcga
ctggatgttgaggatccatcctgtgatcacctgtacttggccaaagacaagaccttacag
gatctcatcttcgatctgtccacctccggttcagggtctgggctgcccttgttcgttcag
aggactgtggccaggacaattgtactgcaggagatcataggaaaaggtcgctttggggaa
gtgtggagggggagatggagaggaggtgatgtggctgtgaagatcttctcatccagggag
gaacgttcctggttccgtgaagctgagatttaccaaaccatcatgctccgccatgaaaac
atcttgggcttcattgctgctgataataaagacaatggcacatggacacagctgtggcta
gtgtcagactaccatgagcatggctcattatttgactatctcaaccactactccgtcaca
atcgaggggatgatcaagttatcgctttcagccgccagcggtctggcacatctgcacatg
gagatcctgggcacacaggggaaaccaggcatcgcacatcgtgacctcaaatccaaaaac
atcttggtgaaaaagaatggtatcttcgccatagcagatctagggctcgctgtacggcac
gagtctatcactgatactatagacattgcaccaaatcagagggtgggcactaaaagatat
atggccccagaggtactagatgaaacgatcaacatgaagcattttgattctttcaagtgt
gctgatatctatgctttgggactggtatattgggagattgcacgacggtgtaatgctgga
ggtatccatgaagattataagctaccctactatgacctggtgccgtccgacccctccata
gaagagatgaggaaggtggtgtgtgaccagaggcttcggcctaagtggcccaactggtgg
cagagctatgaggcgctgagagtgatgggaaagatcatgcgggagtgttggtatgccaac
ggagcggcgcggcttacagctctgcggattaagaagactctttcgcaactcagcgtccaa
gaagacattaagatctga

DBGET integrated database retrieval system