KEGG   Danio rerio (zebrafish): 30262Help
Entry
30262             CDS       T01004                                 

Gene name
ins
Definition
(RefSeq) insulin preproprotein
  KO
K04526  insulin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04068  FoxO signaling pathway
dre04114  Oocyte meiosis
dre04140  Autophagy - animal
dre04150  mTOR signaling pathway
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    30262 (ins)
   04068 FoxO signaling pathway
    30262 (ins)
   04150 mTOR signaling pathway
    30262 (ins)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    30262 (ins)
  09143 Cell growth and death
   04114 Oocyte meiosis
    30262 (ins)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    30262 (ins)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    30262 (ins)
   04914 Progesterone-mediated oocyte maturation
    30262 (ins)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Insulin
Motif
Other DBs
NCBI-GeneID: 30262
NCBI-ProteinID: NP_571131
ZFIN: ZDB-GENE-980526-110
Ensembl: ENSDARG00000035350
Vega: OTTDARG00000042752
UniProt: O73727 B2GSI0
Position
5
AA seq 108 aa AA seqDB search
MAVWLQAGALLVLLVVSSVSTNPGTPQHLCGSHLVDALYLVCGPTGFFYNPKRDVEPLLG
FLPPKSAQETEVADFAFKDHAELIRKRGIVEQCCHKPCSIFELQNYCN
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgtggcttcaggctggtgctctgttggtcctgttggtcgtgtccagtgtaagc
actaacccaggcacaccgcagcacctgtgtggatctcatctggtcgatgccctttatctg
gtctgtggcccaacaggcttcttctacaaccccaagagagacgttgagccccttctgggt
ttccttcctcctaaatctgcccaggaaactgaggtggctgactttgcatttaaagatcat
gccgagctgataaggaagagaggcattgtagagcagtgctgccacaaaccctgcagcatc
tttgagctgcagaactactgtaactga

DBGET integrated database retrieval system