KEGG   Danio rerio (zebrafish): 30295
Entry
30295             CDS       T01004                                 

Gene name
rho
Definition
(RefSeq) rhodopsin
  KO
K04250  rhodopsin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    30295 (rho)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    30295 (rho)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Vision
   Opsin
    30295 (rho)
SSDB
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srw 7TM_GPCR_Srx TAS2R 7TM_GPCR_Srh 7TM_GPCR_Sru CitMHS DUF92 FA_desaturase
Other DBs
NCBI-GeneID: 30295
NCBI-ProteinID: NP_571159
ZFIN: ZDB-GENE-990415-271
Ensembl: ENSDARG00000002193
Vega: OTTDARG00000028940
UniProt: P35359
Position
8
AA seq 354 aa
MNGTEGPAFYVPMSNATGVVRSPYEYPQYYLVAPWAYGFVAAYMFFLIITGFPVNFLTLY
VTIEHKKLRTPLNYILLNLAIADLFMVFGGFTTTMYTSLHGYFVFGRLGCNLEGFFATLG
GEMGLKSLVVLAIERWMVVCKPVSNFRFGENHAIMGVAFTWVMACSCAVPPLVGWSRYIP
EGMQCSCGVDYYTRTPGVNNESFVIYMFIVHFFIPLIVIFFCYGRLVCTVKEAARQQQES
ETTQRAEREVTRMVIIMVIAFLICWLPYAGVAWYIFTHQGSEFGPVFMTLPAFFAKTSAV
YNPCIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaacggtacagagggaccggcattctacgtgcctatgtccaatgccaccggggtagtc
cggagcccatacgaatacccacagtactacctggtggcgccctgggcatatggcttcgtg
gcggcctacatgttcttcctcatcatcaccggcttccccgtcaacttcctcacgctgtac
gtcaccatcgagcacaagaagctgcgcacacccctcaactacatcctgctgaacctggcc
attgccgacctcttcatggtgttcggcggcttcaccaccaccatgtacacctccttgcac
ggctacttcgtgttcggccgcctgggctgcaacctggagggcttctttgccaccctgggc
ggtgagatggggctaaagtcgcttgtagtactggccattgagcgctggatggtggtctgc
aaaccggtcagcaacttccgtttcggggagaaccatgccatcatgggggtggccttcacc
tgggtcatggcctgctcctgtgccgtgccgccactggtgggctggtcgcgttacatcccc
gagggcatgcagtgctcctgcggcgtcgactactacacccgcactcccggtgtcaacaac
gagtccttcgtcatctacatgttcatcgtgcacttcttcatcccactgatagtcatattc
ttctgctatggccggctggtgtgcactgtgaaggaggcggcacggcagcagcaggagtcc
gagaccacacagcgggccgagcgcgaggtcacccgcatggtcatcatcatggtcatcgcc
ttcctcatctgctggttgccctacgccggcgtggcctggtacatcttcacccaccagggc
agcgagttcgggcccgtcttcatgaccctgcccgccttcttcgccaagacgtccgccgtc
tacaacccctgcatctacatctgcatgaacaagcagttccgtcactgcatgatcaccacc
ctgtgctgcggcaagaaccccttcgaagaggaagagggcgcctccaccaccgcctccaag
actgaggcttcgtccgtgtcttccagctccgtgtctccggcgtaa

DBGET integrated database retrieval system