KEGG   Danio rerio (zebrafish): 30428
Entry
30428             CDS       T01004                                 

Gene name
csnk2b
Definition
(RefSeq) casein kinase II subunit beta
  KO
K03115  casein kinase II subunit beta
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03008  Ribosome biogenesis in eukaryotes
dre04137  Mitophagy - animal
dre04310  Wnt signaling pathway
dre04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    30428 (csnk2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    30428 (csnk2b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    30428 (csnk2b)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    30428 (csnk2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dre03009]
    30428 (csnk2b)
   03036 Chromosome and associated proteins [BR:dre03036]
    30428 (csnk2b)
Ribosome biogenesis [BR:dre03009]
 Eukaryotic type
  90S particles
   Kinase
    30428 (csnk2b)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    AUTS2-polycomb complex
     30428 (csnk2b)
SSDB
Motif
Pfam: CK_II_beta CCDC24
Other DBs
NCBI-GeneID: 30428
NCBI-ProteinID: NP_571262
ZFIN: ZDB-GENE-990415-29
Ensembl: ENSDARG00000077776
Vega: OTTDARG00000031721
UniProt: Q91398 Q1LXD2
Position
19
AA seq 215 aa
MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE
ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML
PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA
NQFVPRLYGFKIHPMAYQLQLQAASSFKSPVKAIR
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagtagctcagaggaagtgtcgtggatttcttggttttgtggtctacggggaaatgaa
ttcttctgtgaggtggatgaggactatattcaggacaagtttaatcttacaggactcaat
gagcaagttccccattacagacaagctctggacatgatcctcgatctggaacctgatgag
gagctggaggataaccctaaccagagtgacctgattgagcaggctgctgagatgctctat
gggctgattcatgctcgctatatcctcactaaccgtggcattgcccagatgctggagaaa
tatcagcagggagactttggctactgtcctcgtgtttactgtgagaatcagccaatgctg
cctattggcctctctgacattcccggcgaggctatggtgaagctctactgccccaagtgt
atggatgtgtacacgccgaagtcatccaggcaccatcacactgacggagcttactttggc
accggcttccctcacatgctctttatggtgcatcccgagtaccggccaaaaaggcctgcc
aaccagtttgtgcccaggctttatggttttaagattcacccaatggcttaccagctccag
ctgcaggcagcctccagcttcaagagtcccgtcaaagccatccgctaa

DBGET integrated database retrieval system