KEGG   Danio rerio (zebrafish): 30504Help
Entry
30504             CDS       T01004                                 

Gene name
opn1mw4
Definition
(RefSeq) green-sensitive opsin-4
  KO
K04250  rhodopsin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    30504 (opn1mw4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    30504 (opn1mw4)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Vision
   Opsin
    30504 (opn1mw4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srw 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 TAS2R Cytochrom_B_N_2
Motif
Other DBs
NCBI-GeneID: 30504
NCBI-ProteinID: NP_571329
ZFIN: ZDB-GENE-990604-43
Ensembl: ENSDARG00000000638
Vega: OTTDARG00000001931
UniProt: Q9W6A6
Position
6
AA seq 349 aa AA seqDB search
MNGTEGNNFYIPLSNRTGLARSPYEYPQYYLAEPWQFKLLAVYMFFLICLGFPINGLTLL
VTAQHKKLRQPLNFILVNLAVAGTIMVCFGFTVTFYTAINGYFVLGPTGCAIEGFMATLG
GEVALWSLVVLAVERYIVVCKPMGSFKFSASHAFAGCAFTWVMAMACAAPPLVGWPRYIP
EGMQCSCGPDYYTLNPEYNNESYVLYMFICHFILPVTIIFFTYGRLVCTVKAAAAQQQES
ESTQKAEREVTRMVILMVLGFLIAWTPYATVAAWIFFNKGAAFSAQFMAVPAFFSKTSAL
YNPVIYVLLNKQFRNCMLTTLFCGKNPLGDDESSTVSTSKTEVSSVSPA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcactgaaggaaacaacttctacatccccctgtccaacaggacagggctagca
aggagtccgtacgaatatcctcagtattatcttgcggagccatggcaatttaaactgctc
gccgtctacatgttcttcctcatctgcttaggtttccccatcaatggccttacattgttg
gtaacagctcaacacaaaaagctgaggcaacctctcaacttcattctggtcaatctggct
gtggctggcaccatcatggtttgttttggattcacggtcactttctacacagccattaat
ggatactttgttctgggaccaactggctgtgcgattgagggattcatggccacactggga
ggcgaagttgccctttggtcacttgtagtgctggccgttgagagatacattgtggtttgc
aagccaatggggagtttcaaattttctgccagtcacgctttcgcaggatgcgcattcaca
tgggtaatggccatggcttgtgcagctccccctctggttggttggcccaggtatattccg
gagggaatgcagtgttcatgtggaccagactactacaccctgaacccagagtacaacaac
gaatcatatgtcctctacatgttcatctgtcattttatacttccagttactataatcttc
ttcacctatgggcgacttgtttgcacagtcaaagcggctgcagctcaacagcaggaatca
gaatccactcagaaggctgagagagaagtgaccagaatggtcatcctgatggttctgggc
ttcctgattgcttggactccttatgctactgttgctgcctggatcttctttaataaggga
gctgctttcagtgctcagttcatggctgttcctgcctttttctcaaagacctctgcattg
tataaccctgtcatctatgtgctgctaaataaacagtttcgtaattgcatgctgaccact
ctattctgtggaaagaatcctcttggcgatgatgaatcctctactgtgtccaccagcaag
acggaggtgtcttctgtatctccagcatag

DBGET integrated database retrieval system