KEGG   Danio rerio (zebrafish): 30681Help
Entry
30681             CDS       T01004                                 

Gene name
mapk12a
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04068  FoxO signaling pathway
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04370  VEGF signaling pathway
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre04622  RIG-I-like receptor signaling pathway
dre04625  C-type lectin receptor signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04933  AGE-RAGE signaling pathway in diabetic complications
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    30681 (mapk12a)
   04370 VEGF signaling pathway
    30681 (mapk12a)
   04068 FoxO signaling pathway
    30681 (mapk12a)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    30681 (mapk12a)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    30681 (mapk12a)
   04621 NOD-like receptor signaling pathway
    30681 (mapk12a)
   04622 RIG-I-like receptor signaling pathway
    30681 (mapk12a)
   04625 C-type lectin receptor signaling pathway
    30681 (mapk12a)
  09152 Endocrine system
   04912 GnRH signaling pathway
    30681 (mapk12a)
   04914 Progesterone-mediated oocyte maturation
    30681 (mapk12a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    30681 (mapk12a)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    30681 (mapk12a)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    30681 (mapk12a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    30681 (mapk12a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     30681 (mapk12a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   30681 (mapk12a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Kdo FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 30681
NCBI-ProteinID: NP_571482
ZFIN: ZDB-GENE-990415-257
Ensembl: ENSDARG00000042021
Vega: OTTDARG00000012740
UniProt: Q5U3S2
Position
18
AA seq 363 aa AA seqDB search
MTARSRPGYFRQEINKTIWEVPDRYKDLKQVGTGAYGTVCYALDRRTGAKVAIKKLHRPF
QSDLFAKRAYRELRLLKHMKHDNVIGLVDVFTADLSLDRFHNFYLVMPFMGTDLGKLMKM
ERLSEERVQYLVYQMLKGLKYIHAAGIIHRDLKPGNLAINEECELKILDFGLARQTDSEM
TGYVVTRWYRAPEVILSWMHYTQTVDIWSVGCIMAEMLLGKPLFKGHDHLDQLMEIMKVT
GTPSKEFTAKLQSEDARNYVTKLPRFRKKDLRILLPNVNPQAIKVLEGMLLLDPESRITA
AEALAFPFFSEFREPEEETEAPPYDHSLDEADQSLEQWKRLTFTEILTFQPAPAVAESKE
TAL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccgatcgagacctggctattttcgacaggagataaataaaacaatctgggag
gtgccggatagatacaaagatctgaaacaggtggggacgggggcatatggtacagtatgc
tatgcattagaccggaggacaggggcaaaggtggccatcaagaaactccatcgtcccttc
cagtctgacctgtttgccaaaagagcctatcgtgagctcaggctgctcaaacacatgaag
catgacaatgttatcggactcgtggatgtgttcactgcagacctttccctagacagattc
cacaacttttacttggtcatgcctttcatgggtactgatctgggaaagttaatgaaaatg
gagagactttcagaagagagagtgcagtatctggtctatcagatgttaaaaggcctcaaa
tatatccatgccgctggaatcattcacagggatctcaaaccaggcaatcttgcaataaac
gaggagtgtgagcttaagatcctggattttggcctggctcggcaaacagacagtgaaatg
acgggctacgttgtgacacgctggtacagagcgcctgaggtcattctgagctggatgcat
tacacacagactgtggacatctggtcagtcggatgcatcatggcagagatgctgctagga
aaaccactattcaaaggacacgaccacctggatcagctgatggagatcatgaaggttaca
gggacaccctcaaaagagttcacagcgaagctacagtctgaagatgctagaaactacgtc
acaaagttaccaagatttagaaagaaagatctgcggattctattaccaaatgttaacccg
caagcgattaaagtgttagaaggcatgctgcttttggaccctgagagccggataacagca
gcagaggcactggcttttcctttcttctcagagtttcgtgaaccagaggaggaaaccgag
gctccaccatatgaccattcgctggatgaggctgatcagtcgctagagcaatggaaaaga
ctcacttttacagaaattctgaccttccagccggctcctgcggtggctgaatctaaagag
acggccctctga

DBGET integrated database retrieval system