KEGG   Danio rerio (zebrafish): 30691
Entry
30691             CDS       T01004                                 

Symbol
ephb4b
Name
(RefSeq) ephrin type-B receptor 4b precursor
  KO
K05113  Eph receptor B4 [EC:2.7.10.1]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    30691 (ephb4b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     30691 (ephb4b)
Protein kinases [BR:dre01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   30691 (ephb4b)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 ABC1 Ephrin_rec_like Pur_ac_phosph_N EGF_MSP1_1 Haspin_kinase cEGF DUF6232 Arylsulfotran_N
Other DBs
NCBI-GeneID: 30691
NCBI-ProteinID: NP_571492
ZFIN: ZDB-GENE-990415-65
Ensembl: ENSDARG00000027112
Vega: OTTDARG00000033434
UniProt: O73878
Position
23
AA seq 976 aa
MDRVCWIMALSWFWMVSTGLVSAEEEVLMNTKLETSDLRWTIYPSGDPEWEEMSGLDEEG
NSVRTFQVCPMDSSVSHWLRTRFIPRHGASQVYVEIRFTMMECSAMPASFRTCKETFNLY
YYQSDEDTASATHPAWMENPYSKVDTVAADFLLRRGGERKSNVKTVRVGPLSLFGFYLAF
QTQGACMALLSVRVFFKKCPAVSRAFSSFPETLPHSLVQQAEGVCVDNSAPTGQCTAPPT
MFCGEDGQWVGPPSSTCACKPGYEPVDSDRCRACGLGQYKASVGGSLCRVCPDNSNTHSA
GSSLCVCRPGYHRATSDLPDSACTKPPSAPRSIIYQINDTVVTLEWSEPLDRGGRSDLSY
SVECMHCRGSLCVQCADSITYRPGQMGVSGRRVIIRGLLPHTTYTFTVLAQNGVSAVSHT
SPASSSVNITTSRDVAVPVSGIRRIKASESSVSISWTVPPQTQHSIQDYQLRYSLKGQDD
GWQYVSSRSSSVVLNDLSRASQYQVQVRARTAAGYGHFSSAVSISTLPDDEESPSRLMLT
GVLVAIGLLILIAVVIVAVFCFRRSTRRRDPDPDKSGQFLMGQGIKVYIDPFTYEDPNEA
VREFAKEIDVSFVKIEEVIGAGEFGEVCRGRLKVPGKKENYVAIKTLKGGYTDKQRRDFL
SEASIMGQFQHPNIIHLEGVITASCPVMILTEYMENGALDSFLRLNDGQFTPIQLVGMLR
GIASGMKYLSEMSFVHRDLAARNILVNSNLVCKVSDFGLSRFLTENSSDPTYTSSLGGKI
PIRWTAPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPP
PECPASLHQLMLDCWQKERSSRPRFCAIVSALDRLIRNPASLKITGRIPDGPSHPLLDQR
APPPLSHCSSVADWLRAIKMERYEDAFMQAGFTAIQHITHISTEDLLRIGVTLAGHQKKI
LSSVQTLRIHGGSLRY
NT seq 2931 nt   +upstreamnt  +downstreamnt
atggatcgtgtttgctggattatggctctttcctggttctggatggtgtcgactggactc
gtctcggctgaggaagaggtcctgatgaacaccaagctggaaacatcagacctgagatgg
accatctaccccagcggtgaccccgagtgggaggagatgagcggtctggatgaagagggc
aacagcgtccgcaccttccaggtttgcccgatggacagttctgtgagccactggctgcgc
acacgctttatcccccgccacggcgcgtctcaggtgtacgtggagatccgcttcaccatg
atggaatgttccgccatgccggccagcttccgcacctgcaaggagacctttaacctttac
tactatcagagcgacgaggacacggccagcgccacacaccccgcctggatggagaacccc
tacagcaaggtggacacagttgctgctgacttcctgttgcgtcgcggcggagagaggaag
tccaatgtgaagacggtgcgtgtgggtccgctgtcgttgtttggcttctacctggcgttt
cagactcagggcgcgtgcatggctctgctgtccgtcagggttttcttcaagaagtgtcct
gccgtctcccgcgccttctcctccttcccggagacgctccctcactcgctggtgcagcag
gcggagggtgtgtgcgtggataactccgcccccactggacagtgcacagctccacccact
atgttctgcggggaggacggtcagtgggtggggcctccgtcgtctacatgtgcttgtaaa
ccaggatacgaacctgtcgactccgaccgctgcagggcgtgtggattgggccagtataaa
gcatctgtcggagggagcttgtgtcgtgtgtgtccagacaacagtaacacacactccgct
ggatccagtctgtgtgtgtgtcgtccaggataccaccgagcaaccagtgaccttccggac
tcagcctgcaccaaaccgccatcggctccgcgtagcatcatctatcagatcaatgatacg
gtggtcaccctggagtggtccgagccgctagatcgcggtggacgttctgatctctcctac
agtgtggagtgtatgcactgcagaggctccctatgcgtccagtgtgcagacagcatcacc
tataggccgggtcagatgggcgtgtccgggaggcgtgtcatcatccgtggactcctccca
cacaccacctacaccttcactgtgctggcccagaacggcgtcagcgctgtcagtcacaca
agccccgcctccagctccgtcaacatcactaccagcagagatgtggctgtccctgtgtct
ggtatcaggaggattaaagcatctgagagcagcgtgtccatcagctggacggttcctcca
caaacgcagcacagcattcaggattatcagctgcgctacagtctgaagggtcaggatgat
ggatggcagtacgtcagcagcaggagcagctcagtggttctgaatgatctgagtcgagcg
tcgcagtatcaggtgcaggtcagagccagaaccgctgcgggatacggacacttcagcagc
gccgtcagcatcagcacgctacctgatgatgaagagtctccgtcgcggctgatgctcact
ggtgtcctggttgctataggactgctcatcctcatcgccgtggtgattgttgccgtgttc
tgcttcagacgctcgactcggaggagggatccagacccggataagagcggccagttcctg
atgggtcaggggattaaagtgtacattgatccgttcacgtacgaggacccgaatgaggct
gtgcgggaattcgctaaagagatcgacgtgtcgtttgtgaagatcgaggaggtcatcggt
gccggtgagtttggtgaggtgtgtcgcggccggctcaaggttcccgggaagaaagagaac
tacgtggccatcaagacgctgaagggcggatacacggacaagcagaggcgtgacttcctg
tctgaggcgtcaatcatgggtcagttccagcaccccaacatcattcatctggagggagtg
atcacagcttcctgtcccgtcatgattctgaccgagtacatggagaacggagcactcgac
tccttcctgcggctgaatgatggtcagttcactcctatccagctggtggggatgctgcgt
ggaatcgcgtctggaatgaagtatctgtctgagatgagcttcgttcatcgtgatctggcg
gcgaggaacatcctggtcaacagtaacctggtgtgcaaagtgtccgacttcggcctgtcc
cgattcctgacggagaactcgtctgatcccacctacaccagctcactgggcgggaagatc
ccgatccgctggacggctcctgaagccatcgccttccgcaagttcacctcagcgtcagac
gtctggagctacggcatcgtcatgtgggaggtgatgtcattcggagagaggccgtactgg
gacatgagcaaccaggacgtgataaacgccatcgagcaggactaccgcctgccgcctccc
ccagaatgccctgcgtctctccatcagctgatgctggactgctggcagaaggagagatcg
tcccggccgcgcttctgcgccatcgtctctgccctcgacagactgatccgcaaccctgcc
tcactcaagatcaccggacgcatccctgatgggccgtctcaccctctcctggaccagcgt
gctcctcctccgctctctcactgcagctcagttgctgattggctgagagccataaagatg
gagcgatacgaggacgcgttcatgcaggccggattcacagccatccaacacatcacacac
atctccactgaggatcttctgcggatcggcgtgactttagcgggacaccagaagaagatt
ctgtccagcgtccaaacactgcgcatccacggcggatccctgcgatactga

DBGET integrated database retrieval system