KEGG   Danio rerio (zebrafish): 30718Help
Entry
30718             CDS       T01004                                 

Gene name
notch1a
Definition
(RefSeq) neurogenic locus notch homolog protein 1 precursor
  KO
K02599  Notch 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04330  Notch signaling pathway
Module
dre_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    30718 (notch1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Ank_2 EGF_2 Notch Ank NOD NODP DUF3454 Ank_5 Ank_3 Ank_4 Gram_pos_anchor EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 30718
NCBI-ProteinID: NP_571516
ZFIN: ZDB-GENE-990415-173
UniProt: P46530
Position
21
AA seq 2437 aa AA seqDB search
MNRFLVKLTLLTAASLATVAQGQRCSEYCQNGGICEYKPSGEASCRCPADFVGAQCQFPN
PCNPSPCRNGGVCRPQMQGNEVGVKCDCVLGFSDRLCLTPVNHACMNSPCRNGGTCSLLT
LDTFTCRCQPGWSGKTCQLADPCASNPCANGGQCSAFESHYICTCPPNFHGQTCRQDVNE
CAVSPSPCRNGGTCINEVGSYLCRCPPEYTGPHCQRLYQPCLPSPCRSGGTCVQTSDTTH
TCSCLPGFTGQTCEHNVDDCTQHACENGGPCIDGINTYNCHCDKHWTGQYCTEDVDECEL
SPNACQNGGTCHNTIGGFHCVCVNGWTGDDCSENIDDCASAACSHGATCHDRVASFFCEC
PHGRTGLLCHLDDACISNPCQKGSNCDTNPVSGKAICTCPPGYTGSACNQDIDECSLGAN
PCEHGGRCLNTKGSFQCKCLQGYEGPRCEMDVNECKSNPCQNDATCLDQIGGFHCICMPG
YEGVFCQINSDDCASQPCLNGKCIDKINSFHCECPKGFSGSLCQVDVDECASTPCKNGAK
CTDGPNKYTCECTPGFSGIHCELDINECASSPCHYGVCRDGVASFTCDCRPGYTGRLCET
NINECLSQPCRNGGTCQDRENAYICTCPKGTTGVNCEINIDDCKRKPCDYGKCIDKINGY
ECVCEPGYSGSMCNINIDDCALNPCHNGGTCIDGVNSFTCLCPDGFRDATCLSQHNECSS
NPCIHGSCLDQINSYRCVCEAGWMGRNCDININECLSNPCVNGGTCKDMTSGYLCTCRAG
FSGPNCQMNINECASNPCLNQGSCIDDVAGFKCNCMLPYTGEVCENVLAPCSPRPCKNGG
VCRESEDFQSFSCNCPAGWQGQTCEVDINECVRNPCTNGGVCENLRGGFQCRCNPGFTGA
LCENDIDDCEPNPCSNGGVCQDRVNGFVCVCLAGFRGERCAEDIDECVSAPCRNGGNCTD
CVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGISSFSCVCLPGFTGNYCQHDV
NECDSRPCQNGGSCQDGYGTYKCTCPHGYTGLNCQSLVRWCDSSPCKNGGSCWQQGASFT
CQCASGWTGIYCDVPSVSCEVAARQQGVSVAVLCRHAGQCVDAGNTHLCRCQAGYTGSYC
QEQVDECQPNPCQNGATCTDYLGGYSCECVPGYHGMNCSKEINECLSQPCQNGGTCIDLV
NTYKCSCPRGTQGVHCEIDIDDCSPSVDPLTGEPRCFNGGRCVDRVGGYGCVCPAGFVGE
RCEGDVNECLSDPCDPSGSYNCVQLINDFRCECRTGYTGKRCETVFNGCKDTPCKNGGTC
AVASNTKHGYICKCQPGYSGSSCEYDSQSCGSLRCRNGATCVSGHLSPRCLCAPGFSGHE
CQTRMDSPCLVNPCYNGGTCQPISDAPFYRCSCPANFNGLLCHILDYSFSGGQGRDIAPP
VEVEIRCEIAQCEGRGGNAICDTQCNNHACGWDGGDCSLNFDDPWQNCSAALQCWRYFND
GKCDEQCATAGCLYDGFDCQRLEGQCNPLYDQYCRDHYADGHCDQGCNNAECEWDGLDCA
DDVPQKLAVGSLVLVVHIPPDELRNRSSSFLRELSSLLHTNVVFRRDANGEALIFPYYGS
EHELSKHKRSDWTDPGQLMQRARRSLTSFLKPRTRRELDHMEVKGSIVYLEIDNRQCFQQ
SDECFQSATDVAAFLGALASSGNLNVPYIIEAVTSEGGPPKTGEMYPMFLVLLALAVLAL
AAVGVVVSRKRKREHGQLWFPEGFKVNEPKKKRREPVGEDSVGLKPLKNSDSSLMDEQLS
EWAEDDTNKRFRFEGQSILEMSGQLDHRQWTQQHLDAADLRLNSMAPTPPQGQIENDCMD
VNVRGPDGFTPLMIASCSGGGLENENGEAEEDPSADVITDFIYHGANLHNQTDRTGETAL
HLAARYARSDAAKRLLESCADANVQDNMGRTPLHAAVAADAQGVFQILIRNRATDLDARM
HDGTTPLILATRLAVEGMVEELINCHADPNAVDDSGKSALHWAAAVNNVDAAVVLLKNGA
NKDLQNNKEETPLFLAAREGSYETAKVLLDHLANRDIADHLDQLPRDIAHERMHHDIVRL
LEEYNLVRSPPLPLSPPLCCPNTYLGIKPSPGNNNNTAKKTRKPGGKGVGGKDSGKDIRT
KKKKSGDGKNGGIMEVGVLSPVDSLESPHGYLSDVSSPPMMTSPFQQSPPISLNQLQGLA
DSHMGGALQGLGKPFDSAPRLSHLPVANNVGGAQAGACDWLQRVQQQQQQQQQQQQAGML
MPTMLSATNMPQVMGYPTMQSSHLGAPSHMIAHQNMAPMQHQNISHHFLGDLSGLDLQSS
SGHAPIQTILPQDSQRMAPPISSTQFLTPPSQHSYSNPMDNTPNHQQVPDHPFLTPSAGS
PDQWSSSSPHSNLSDWSEGISSPPTSMQMNHIPEAFK
NT seq 7314 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtttcttggtgaaattaacgctactgactgcagcatcgctcgcgacggtggca
caagggcaaagatgctcagaatactgtcagaatggaggaatatgcgagtacaagcccagc
ggagaagcatcatgcaggtgtcctgcagacttcgtgggtgctcaatgtcaattcccgaac
ccctgcaacccatccccatgtcgtaacggaggtgtgtgtcggccgcagatgcagggcaat
gaagtgggtgtgaagtgcgactgtgtgttaggattcagtgaccggctctgtctgactcca
gtcaatcatgcttgcatgaactctccctgccggaacggaggaacctgctctctgctcaca
ctcgataccttcacctgccgctgccagcccggatggtcaggtaaaacgtgtcagctggcg
gacccgtgcgcctccaacccgtgcgctaacggcggtcagtgttcagcgtttgagtcgcac
tacatctgcacgtgtcctccgaacttccatggtcagacgtgccggcaggacgtgaacgag
tgtgcagtttctccgtcgccctgcaggaacggcggcacctgcattaatgaggtgggctct
tacctgtgccgctgcccgcccgagtacaccggcccacactgccagcgcctctaccagccc
tgcctgccctcgccctgcaggagcggaggaacctgcgtgcagaccagcgacaccacacac
acatgctcctgcctgccaggcttcacaggtcagacgtgtgagcataatgttgatgattgt
actcaacacgcctgtgagaacggcggaccgtgcatcgacggcatcaacacctacaactgc
cactgcgacaaacactggaccggtcagtactgtacagaggatgtggacgagtgtgaactg
tctccaaacgcctgtcagaatggcgggacatgccacaacaccatcggcggtttccactgc
gtgtgtgtgaacggttggactggcgacgactgcagcgaaaacatcgacgactgcgccagc
gctgcctgctcgcacggagccacctgccacgaccgcgtcgcctccttcttctgcgagtgt
ccacacgggcgcaccggtcttctgtgccacctggacgatgcctgcatcagtaacccgtgt
cagaaaggctcaaactgcgacacaaacccagtgagcgggaaagccatctgcacctgcccg
cccggatacactggatccgcctgcaaccaggacatcgacgagtgctcgcttggtgcaaac
ccctgtgagcacggcggccgctgcctcaacactaaaggctccttccagtgcaagtgtctg
caaggctatgaagggccaagatgtgaaatggacgtcaatgagtgcaagtcgaacccctgc
cagaacgacgcaacctgcctcgaccagattggaggatttcactgcatctgcatgcctgga
tacgagggtgtgttttgtcagatcaactctgatgattgtgcatctcagccgtgtctcaac
ggaaaatgcatcgacaaaatcaactcgttccactgcgaatgccctaaagggttttctggg
agtttgtgtcaggtggatgtggatgaatgtgccagtacgccgtgtaaaaatggagctaag
tgcacagacggacccaacaaatacacctgtgaatgcaccccaggtttttctggcattcac
tgtgagctggacatcaacgagtgtgcgtcgagcccttgtcattatggtgtgtgtcgtgac
ggtgtggcctccttcacctgcgactgccggcctggatacaccggacgcttgtgtgaaacc
aacatcaacgagtgtctgagccaaccctgccgaaacggaggaacctgccaggacagagag
aacgcctacatctgtacctgtcctaaaggaaccacaggtgtgaactgcgagatcaacatt
gacgactgcaagagaaagccatgtgactatggaaagtgcatagacaagattaatggctat
gagtgtgtctgcgaacccggatactcaggctcaatgtgcaacatcaacattgacgactgc
gcgttgaacccatgccacaacggcggcacctgtattgacggtgtgaacagctttacctgt
ctgtgtcccgacggttttcgggatgccacctgcctctcgcagcacaacgagtgctccagc
aacccctgcatccacggcagctgcctggaccagatcaacagctacaggtgtgtgtgtgag
gccggctggatgggccgcaactgcgacatcaacatcaacgagtgcctgtccaacccctgc
gtgaacggaggaacctgcaaagacatgaccagtggatacctgtgcacatgcagagccgga
ttcagcggtccgaactgccagatgaacattaatgagtgtgcgtcgaacccgtgtctgaac
cagggctcctgcattgacgacgtggctggattcaagtgcaactgcatgctgccgtacaca
ggtgaggtgtgtgagaatgttttagccccttgttctccacgtccctgtaaaaacggcggt
gtgtgtcgtgaatctgaggatttccagagcttctcctgtaactgtccggctggatggcaa
ggtcaaacgtgtgaggtggacattaatgagtgtgtgaggaacccgtgcactaatggagga
gtgtgtgaaaacctgcgcggtggatttcagtgccgctgcaatcctggattcactggagct
ctatgtgaaaacgacattgacgactgcgagcccaacccgtgcagtaacggcggcgtgtgt
caggacagggtcaatggttttgtgtgtgtgtgtttggctggttttcgaggggagcgctgt
gcagaagacattgatgagtgtgtgagcgccccctgcaggaatggtggaaactgcacagac
tgtgttaacagctatacctgcagctgccctgcgggcttcagtggcatcaactgtgagatc
aacacacccgactgcaccgagagctcgtgttttaacggcgggacgtgtgtggatggcatc
agctcgttctcctgcgtgtgtttgccgggatttactgggaattactgtcagcatgatgtg
aacgagtgcgactctcggccatgtcagaacggcggctcctgtcaggacggatacggcacc
tataaatgcacatgtccacacggctacaccggactcaactgccagagtctagtgcgctgg
tgtgactcgtctccctgtaagaacggaggctcgtgttggcagcagggggcgtccttcacc
tgtcagtgtgccagcggctggactggcatctactgcgacgtgcctagtgtcagctgtgag
gtcgctgccagacagcaaggtgtgtctgtggcagttttgtgtcgtcatgcgggtcagtgt
gttgatgcaggaaacacacacctgtgcaggtgtcaggctggatacaccggcagttactgt
caggagcaggtggacgagtgtcagccgaacccctgccagaatggagccacgtgcacagac
tatctgggaggatacagctgtgagtgcgttcctggatatcatggtatgaactgcagcaag
gagataaacgagtgtctttctcagccctgccaaaatggaggaacctgcatcgacctcgtg
aacacctacaaatgctcctgcccacgaggaacacaaggagttcactgtgagattgatatt
gatgactgttctccatctgtggatccgttaaccggagagccgcggtgttttaacggcggg
cggtgtgtggatcgtgtcggtggttacggttgtgtgtgtccggctggttttgtgggcgag
cgttgcgagggtgacgttaacgagtgcctgtcagacccctgtgaccccagcggatcctac
aactgtgttcagctcatcaacgacttccgctgcgagtgccgtacaggatacaccgggaag
cgctgtgagacagtcttcaacggctgcaaggacacgccatgcaaaaatggaggaacttgt
gctgtagcgagcaacaccaaacacggatacatctgcaaatgccagcctggttactccggc
tcatcctgcgagtatgactctcagtcgtgcggctcgctgcgctgtcgtaatggtgccacc
tgtgtctccgggcacctgagccctcgctgtctgtgtgcaccgggcttcagtgggcatgaa
tgccaaactcgcatggactcgccgtgcctagtcaacccgtgctacaacggcggcacctgc
cagccaatcagcgatgctccattttaccgctgctcctgcccggctaacttcaacgggctg
ctgtgccacattctggactattcgttcagcggtgggcagggtcgggatatcgccccacca
gtcgaagtggaaatccgttgcgaaatcgcccagtgcgaaggacgcggcggaaacgccatc
tgtgatacgcagtgtaataatcacgcatgcggatgggacggcggtgactgctctctgaat
ttcgacgacccctggcagaactgtagcgccgccctgcagtgctggaggtacttcaatgat
gggaaatgtgacgagcagtgcgccaccgcgggctgtctttatgacggatttgactgtcag
cggctggagggacagtgcaatcctctgtatgaccagtactgcagggatcactatgcggac
ggtcactgtgatcagggctgtaataacgcagagtgtgaatgggacggtctggactgcgct
gatgacgtcccgcagaagctggcggtgggcagtttggttctggtggtccacatcccgccg
gacgagcttcgaaatcgctcctcatcgttcctccgcgagctcagcagcctgctgcacact
aatgtggtgtttcggcgcgacgccaacggagaggcgctaatcttcccgtactacggtagc
gaacacgagctcagcaaacacaagcgctctgattggacagatcctggtcagctgatgcag
cgtgccaggaggagtctgacatcatttttgaagccccgcacacgcagagagctcgaccac
atggaggtcaaagggtctatcgtgtatctggagattgataaccgtcagtgttttcagcag
tctgatgagtgttttcagagcgcgaccgatgtggccgctttcctcggagctctggcctcc
agtggaaacctcaacgttccctatatcatcgaggccgtcaccagtgaaggtggtccccca
aagactggtgagatgtaccccatgttcctggtcctgttggctctggctgttctggctctg
gccgctgtcggtgtggtcgtctccaggaagaggaagcgggaacatggccagctttggttc
cccgagggatttaaagtcaacgaacccaaaaagaagaggagagaaccagtgggagaggac
tctgtcggactcaagcctttgaaaaactcagacagctctctgatggatgaacagctgagc
gaatgggctgaagacgacaccaataaacgattccggtttgaggggcagagcattctggag
atgagcggtcagttggatcaccgtcagtggactcagcagcatctggacgctgcagacctg
cgcttgaactcgatggctccgacgccgccgcaggggcagatcgaaaacgactgcatggac
gtcaatgtccgcgggcctgacggattcactccactgatgatcgcatcgtgtagcggcggc
ggtcttgaaaatgaaaacggcgaagcagaagaagatccgtccgctgacgtgatcacagat
tttatttatcacggagccaacctgcacaatcagacagaccgcacaggcgagaccgcactt
catctggcagcacgatacgctcgctcggatgctgctaaacgtctgctggagtcgtgcgcc
gatgctaatgtgcaggataacatgggccggacaccgctgcacgccgccgtcgctgctgat
gcacagggagtcttccagatcctcattcggaaccgagcgacggatctagacgcccgcatg
catgatgggacgacgccgctgattctggccacccgattggctgttgagggaatggtggag
gagctcattaactgccatgcagatccgaatgctgttgatgattcaggtaaatcagctctt
cactgggcggctgctgttaataatgtggatgctgctgtcgtgctgttgaagaatggagct
aataaagatctgcagaataataaggaggaaacgcctcttttcctcgctgctcgtgaggga
agttacgaaacggctaaagtcctgcttgatcacttggccaatcgggatattgcagatcac
ctggaccagctgccccgggacatcgctcatgagcgcatgcaccacgatatcgtgcgtctg
ttggaggaatataaccttgtccgaagccccccgctacccttatcacccccgctctgctgc
ccaaacacatacctgggcatcaaacccagcccaggaaacaacaacaacacggctaagaaa
acacgcaaacccggaggaaaaggtgttggagggaaagacagcgggaaggacatcagaacc
aaaaagaaaaagagcggagatggcaaaaacggcgggattatggaagtgggcgtcctctcg
cctgttgattcgctggagtctccacacggctacctatcagacgtctcgtctccgcccatg
atgacatcacccttccagcagtctccgcccatcagtttaaatcagctccagggattggcc
gactcccacatgggtggagctcttcagggtttagggaagccttttgactccgcccctcgt
ttatcccatctgccggtggccaacaatgtgggtggagctcaagcaggcgcttgtgattgg
ctgcaaagggtgcagcagcagcagcaacaacaacaacaacaacagcaggcaggcatgcta
atgcctacaatgctctctgctactaatatgccacaagtcatgggctatcccaccatgcaa
agcagccatcttggtgcaccgtcacacatgatcgcccatcaaaacatggcgccaatgcag
caccaaaacatctcgcatcacttcctcggggacctcagtgggctggatcttcagtcaagc
tcaggacacgcccccattcagaccatcctaccgcaggacagccagcgcatggctccgcct
atttctagcacgcagtttctgactccgccttctcagcatagctattctaaccctatggac
aacacacccaatcaccagcaggtcccagaccacccgttcctcacaccctcggccgggtct
cccgaccaatggtccagctcatctccacattccaacttgtctgattggtcggaaggaatc
tcgagcccgcccaccagtatgcagatgaaccatattccagaagccttcaagtag

DBGET integrated database retrieval system