KEGG   Danio rerio (zebrafish): 30742Help
Entry
30742             CDS       T01004                                 

Gene name
bmpr1ba
Definition
(RefSeq) bone morphogenetic protein receptor type-1B precursor
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04060  Cytokine-cytokine receptor interaction
dre04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    30742 (bmpr1ba)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    30742 (bmpr1ba)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    30742 (bmpr1ba)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dre04090]
    30742 (bmpr1ba)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     30742 (bmpr1ba)
Protein kinases [BR:dre01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   30742 (bmpr1ba)
CD molecules [BR:dre04090]
 Proteins
  30742 (bmpr1ba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2 APH
Motif
Other DBs
NCBI-GeneID: 30742
NCBI-ProteinID: NP_571532
ZFIN: ZDB-GENE-991208-8
Ensembl: ENSDARG00000104100
Vega: OTTDARG00000033020
UniProt: Q9W629
Position
5
AA seq 530 aa AA seqDB search
MDLYRSCLRWLCVLLIGLLGLVEENLANVLDSMLLRNSGKVEERRETGSDAPALPQRFLW
CYCYHHCPEDSTNNTCRTDGYCFTMVEEEGGAAVVTSGCLGLVGSEFQCRDTGNSKQRRA
LECCTDQDYCNRDLHPTLPPLRTPSYVVGDIHHIALLISVSVCSFILTFIIIFCYFRYKR
HELAPRYSLGLHPDESFIPAGESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVTQIGK
GRYGEVWMGRWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHDNILGFIAADIKGTGSW
TQLYLITDYHENGSLYDYLKCTTLDSRAMLKLAYSSVSGLCHLHTEIFGTQGKPAIAHRD
LKSKNILVKRNGACCIADLGLAVKFISDTNEVDIPLNTRVGTKRFMAPEVLDETLNRNHF
QSYIMADMYSFGLILWEISRRCVTGGIVEEYQLPYHDHVPNDPSYEDMREVVCIKRIRPS
FPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKV
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggatctctataggagctgcttgcgttggctgtgtgtgctgctcattgggcttctggga
ctcgtggaggaaaacttggccaatgttttggactctatgctgctgaggaattctgggaag
gtggaagagcgtcgggagacaggaagtgatgcgccagctttacctcagcgcttcctttgg
tgttactgttatcatcactgtccggaggactccacgaataacacgtgcaggacagacggc
tactgcttcaccatggtggaggaagagggtggagcggctgtagtgacgtcaggctgtctg
ggtctggtgggatcagagtttcagtgccgagacacagggaactccaagcagcggcgggcg
ctcgagtgttgtacagatcaagactactgtaaccgagacctgcacccaacactgcctccg
ctacgcacacctagttatgtggttggagacattcatcatatcgctctgctcatctcagtg
agcgtctgtagcttcatcctcaccttcatcatcatcttctgttacttcagatataagcgt
catgaattagcaccgcgctacagtctcggtctacatccagacgaaagcttcattcctgct
ggagaatctctgcgggatctcatagagcaatcccagagctccggttctggctcaggactc
cctctactggtgcagcgcactatagcgaagcagatccagatggtgacacagatcgggaag
ggtcgctatggagaagtgtggatgggaagatggagaggagagaaagtagctgtgaaagtg
tttttcaccacagaggaggccagctggttcagagagaccgagatctatcagaccgtcctc
atgagacatgacaatatactgggatttatagcggctgatattaaaggcacaggctcgtgg
acgcagctctacctgatcacagactatcatgagaacggctctctgtacgactatctgaag
tgcaccacgctggacagcagagccatgctgaaacttgcctattcctccgtctcgggcctt
tgccatttgcacaccgagatcttcggcacgcagggaaaaccagccatcgcccaccgagat
ctgaagagcaaaaacatcctggtcaagagaaacggagcttgctgcatcgctgacctcggc
ctcgctgtcaagttcatcagcgacactaatgaagttgacatccctctgaacactcgtgtg
ggaaccaaacgcttcatggctcctgaagttctggacgagacgctgaacaggaaccatttc
cagtcctacatcatggcagacatgtacagctttggcctcatcctgtgggagatcagcaga
cgctgcgtcaccggaggtatagtagaggagtatcagctgccgtatcatgatcatgttccc
aatgacccgtcatatgaagacatgagagaggtggtctgcatcaagaggatacgaccctcc
ttccccaaccgctggagcagtgatgagtgtctccgacagatggggaagctcatgacagag
tgttgggctcataatccggcctctcgtctcacagccctccgcgttaaaaagactctggcc
aagatgtctgaatcccaggacattaaagtctga

DBGET integrated database retrieval system