KEGG   Danio rerio (zebrafish): 30762
Entry
30762             CDS       T01004                                 

Gene name
mhc2dab
Definition
(RefSeq) major histocompatibility complex class II DAB precursor
  KO
K06752  MHC class II antigen
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04145  Phagosome
dre04514  Cell adhesion molecules
dre04672  Intestinal immune network for IgA production
dre05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    30762 (mhc2dab)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    30762 (mhc2dab)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    30762 (mhc2dab)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    30762 (mhc2dab)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    30762 (mhc2dab)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   30762 (mhc2dab)
  Exosomal proteins of epithelial cells
   30762 (mhc2dab)
  Exosomal proteins of breast milk
   30762 (mhc2dab)
SSDB
Motif
Pfam: MHC_II_beta C1-set C2-set_2 Ig_3
Other DBs
NCBI-GeneID: 30762
NCBI-ProteinID: NP_571551
ZFIN: ZDB-GENE-980526-200
Ensembl: ENSDARG00000079105
Vega: OTTDARG00000042736
UniProt: Q1MTC8 Q8MGW8
Position
8
AA seq 250 aa
MYLLKPFLVILMLSTFTGTADGYYDYIKQQCFYSTSDYSDMVYLASYSFNKVVDTQFNSS
VGKFVGYTEQGLIFAENFNKDQAYLHQLKAQVDTFCRHNAQIWDSAVRDKAVLPEVTIKS
VRQAEGRHPAVLLCSAYEFYPKKIKMSWLRDGKEVTSDVTSTMEMADGDWYYQIHSHLEY
TPKSGEKIQCLVEHASLTQPLTKDWNPHISESDRNKFAIGASGLVLGIIIAIAGLIYYKK
KSTGRILVPN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtatctgttaaaaccttttcttgtcatactgatgctgtcgacatttactggaacagct
gatggatattacgactatatcaagcagcaatgcttctacagcaccagtgattacagtgat
atggtgtatcttgcttcatattccttcaataaagttgtggatactcagttcaacagctct
gtggggaagtttgtggggtacactgaacagggactgatatttgcagagaacttcaacaaa
gaccaggcctacttgcatcaattgaaagctcaagtggacacattctgcagacataatgct
cagatctgggactcagctgtacgtgataaagcagtactaccagaggtaacaatcaagtca
gtgaggcaggctgaaggcagacatccagctgtgttgctgtgcagtgcatatgaattctac
cctaaaaaaatcaaaatgtcctggctgagagatggtaaagaggtgacctcagatgtgacc
tccactatggagatggctgatggagactggtactatcagattcattctcacctggaatac
acccctaaatctggagagaagatccaatgtttggtggagcacgccagcttaactcaacct
cttactaaagattggaatccccatatctctgagtctgacaggaataaatttgccatcgga
gcatctggtctggtgctgggaatcatcatagcgattgctggactcatttactacaagaag
aaatcaacagggagaatcctggtaccaaactga

DBGET integrated database retrieval system