KEGG   Danio rerio (zebrafish): 317731
Entry
317731            CDS       T01004                                 
Symbol
ttn.2
Name
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    317731 (ttn.2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    317731 (ttn.2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dre04812]
    317731 (ttn.2)
   04147 Exosome [BR:dre04147]
    317731 (ttn.2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     317731 (ttn.2)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   317731 (ttn.2)
Membrane trafficking [BR:dre04131]
 Others
  Actin-binding proteins
   Others
    317731 (ttn.2)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     317731 (ttn.2)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   317731 (ttn.2)
SSDB
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_2 C2-set_2 Pkinase Receptor_2B4 C1-set PK_Tyr_Ser-Thr Ig_6 Ig_5 THB Ig_4 Adeno_E3_CR1 bMG6
Other DBs
NCBI-GeneID: 317731
NCBI-ProteinID: XP_021334745
ZFIN: ZDB-GENE-030113-2
UniProt: A0A8M9QKG2
Position
9:complement(42895816..43073959)
AA seq 31468 aa
MTTQAPTFTQPLQSVVALEGSAATFEAQVSGNPVPEVSWFRDGQVLTAAALPGAQISFSD
GRAVLMIPAVTAAHSGRFSVRATNGAGQATSTAELLVTAETAPPNFIQRLQSLTVRQGSQ
VRLDVRVTGIPAPVVKFYREGAEIQSSADFQIVQDGDLYSLLIAEAFPEDSGTYSVSASN
SSGRATSTAELLVQGEEEAVPAKKSKTIISASQISQTRQTRVEKRVEARFEATATMQMQV
ESGVVTEHLAHKTPPRVPPKPTSKSPPSQLTKVSTARQQSPSPVRHVKGPTPTPVRAVSP
STRLSVSPIRPVKSPVMTRKQVTPSSEVLPPWKQAGYVSEASYTQMIAGTTQVQTSTQVQ
MEQRWEGSVAGVKEGDGKKAEAVATVLAAVDHARIRKPMHVEGPQMEEETDVRHQEMLAT
KQQVTSKKELLLIPPEMTTTSTEKTVHVTQIQRATEVSSKVETDLAPSPVPHFTVSKVTV
PKPDHSYEVSRAGSAIATLQKELSTTTASQKIIKPVKPPSHKIVETHVTPEPTPSPFRDT
TERYQTHFDTELHRKIGISYAGEEWDTKVPETAAIPSAVKEPVVPPTLIAGLKNVTVTEG
ESVTLECQISGHPTPAIMWFREDYRIENSIDFQITYEKSYARLMIREAFAEDSGRFTCTA
TSEAGTISTSCYLLVKVSEEIESREEITVQEKQTVVEAKDETMSEISSVSVDTGAPAAPF
FVKKPVVQKLVEGGSVVFVCQIGGSPKPHIYWKKSGVPLTTGYRYRVSHNKDTGECKLEI
SMTFADDAGEYTIFAKNQHGETSASTSLLEEEEFEAYMKKQDVTYVTEVTAMVQEPKVAD
VPPVVVSEYEKELIQRRMAQQTQMMQTFISETEFQISAIERKIIQEIEIRILKITYQELV
IEDGEEMVINVAEHEAVASSFSTPVKSYRILEGMGVTFHCKMGGKPLPKIAWYKDGKRIK
HGGRYQMEVLQDGRASLRLPVVLPEDEGIYTAFASNMKGNAVSSGKLYVESTAAAQPYYP
QAEAVRRVQSTSPMSARSASYSPGRSPARSVSRSPARRLDDTDESQLERLYKPVFVQKPS
SFRCSEGQTARFDLKVVGRPMPDTFWFHSGQQVVNDYTHKIVVKEDGTQSMIVVPAMPQD
SGEWTVVAQNRAGKTTVSMTLTVEAKENLVRPQFIEKLKNISVKEGSLVELAVKAIGNPL
PDIVWLKNSDIISPHKYPHIKIEGAKGQAHFQIPQTSGSDSAWYTATAINKAGRDTTRCR
VNVEVEYTEPVPERRLIIPKGTYKAKDVAPPEIEPLHLRYGQEQWEEGDLYDKEKQQKPH
FKKKLTSVRMKRFGPVHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDY
EVAYSRDSGVITCRATNKFGADQTSATLIVKDEKSLVEDSQLPEGRKVQRMDEMERIAHE
GGPSGVTGDDMSEKSKPEIVLLPEPIRVFEGETAKYRCRVTGYPTPKVNWYLNGLLIRKS
KRFRLHYDGIHYLEITDCKSYDSGDVRVLAENPEGTAEHTVKLEIQQKEDFRTILRRAPE
LKAPEAPGPEPGRVSFDVVKVDKPTDASQAKEVVRLRKAERVVHERSTEETEELRSKFKR
RTEEGYYEAISSVELKSRRKDESYEGMLKKRKEELLHWTKEVSEAEKKKEEEERKLTIPT
IRPEKVALSPSMEAPKILERIQSQTVALADEVRFRCRVIGKPDPECQWFKNGILLEKSDR
VYWYWPEDHVCELVIRDVLAEDSASIMVKAINIAGEASSHAFLLVQAKQVVSFTQTLEDA
YAKEKDTMVTFECETNEPFVKVKWMKNNAEIFSGDKYRMHSDRKVHFLSVLIINMQDDAE
YSCAVVDDDHIRTTARLYVEGAPLEIVKNLESVEVPETYSGEFECELSREDAEGTWYFEN
KEITPSLKYVVSSRRGRHTLSVKDVRKEDQGKYTFKVGDLKTSATLKMKLRPVTLMQGLS
DLTICEGDIAQLEVRFSQENVEGTWMKNGLPISASDRVHIVIDKLVHKLLVENVNKDDAG
IYSFVVPIQDISTSGKLTVQSIEIISHLKDVHSIEGTKAVLEAKISASDVAAVKWYQNDK
LLVASERIQMVAKGTKQRLVLNRSFGSDEGQYKMAVGRVETTCNLTVEKVSIIKHMEDCV
CTETQNVTFEVELSHTGIDAYWTFKNQPLKAGPKYKIESKGKHYSLTIINAMKDEEGLYA
FAAGEKISSAKLTVSGGAINRPLHDVTVAESQTAVMECEVANPTSEGKWLKDGHSVDFSD
IVRSEDIDAVRRLIFVITRPQDIGEYTYQVANSKTSANLRVEAVKIKKTLKNQTVTETQE
AVFSLELTHLDVKGSQWIKNGVEIEPSDKYEITVDGLVHTLKIKNCNSQDESVYGFKLGK
LSANARLNVETIKIVKKPKDVTSLVNGTASFELSLSHDDIPVKWMFKNQELKPSANVQIM
SERKAHKLVIQNVEESNDGEYTAVVGHLQCSAYLHVESLRVTKPLKNLEVPETHVATFEC
EVSHFNVPSTWLKNGVEIEMSEKFRIVVQGKLHQLKIMNTSRDDSAEYTFVCGNDKVSAT
LTVSPVLITSMLKDLNAQEKDTITFEVTVNYEGITYKWLKNGVEIRSSDRCQTRTKQLSH
SLTIRNVHFGDVGDYKFVAGSAETAAKLFVEARVIEFTKHIKDIKVTEKKKAVFECELSE
PNVQVTWMKDGQELELSERYKVSTERHVHRLMIQTVRMSDAGEYSVVAGSSVSKANLTVE
GKDVRISEPAEKEITVLEKQRSTFEFEVNEDDIEGRWLRNGVEIQFSVDQRFNYAIIRKI
HRLTITETYRSDAGEYTFIAGKNRSIVTLHVNIPEPPQIIRHMQPLSVEAGKPARFSVEV
TGIPQPQVSWYKNSQALSSGFKCKFLREGNEHTLLLIEVFPEDAAQYNCEAKNDYGVATS
SASLNVEVPEVVSPDTGAPLSPPVVLTPIQNTSANEGQSARFQCRVSGEDLTITWYCKDK
EIKQSDIFRVSQFDENCQLEITRVYPEDEGEYTCVARNSAGMVSCSALLKVDVTRVREEI
EAKIEEEVKEFSSLTVKTEEEEETYSTSLHLPEKSKTLELKPEQKRFSSSLERKREKPVF
ESKLTPAEVTIGESVRFTVTVSGFPKPKVQWFHNGKAITSSSIYTFVEERDEYSLIITKV
KKDYEGEYSCTASNRFGQTTCKTILKVELSQLSAAEKWVEKMFKIPGQPPCFTTQIQPVQ
CVEGSEVKFLYKVTGTPFPDVQWFKGNSQIKSSQTCSVVCNPDGSGFLIMSNIQQRDSGL
YTCKAVNPFGEASCSAELIVFHKQVSVFHKQQLVQEQKSYKVSMKEEATESRLYSVSLPG
QAGASLQGDHQVIYTIGTEDRQMVESEQVDTLHDLDVSIATVHKEQVTHQAALLQSHEVQ
ERVISAQVRPEPVVATPLRQLQMATMTSAVQESQGFTEQHFERIKSPEVTEIQIAKEHPS
QVMSALTESVTPLTIVKAEPLSTLETEKIKASPEPKYPISSHQVETKLPIVKEHSEVIPH
TQQEKGYQVKEGVKILYSAVSSEKQQFTEGHSKELSTEEPTFQTSVKKEQHKPVVLSVNE
TTQTLSKEESLSVQKPGVETASQVKDSVFKSALVAEEKHQLQADQSSLIPGLDSAISVQP
LREEEQVQHLQVITDQGILPAEGRFSSENPSPEKADAQKSPLLKHTVSVDLQQTVTCEES
SEFSGQVTELSIQPGKAAPAPLHLQAVHSENLLTKEGIISMEKPDEQTAVQKQEKARHHA
ASTEEKIEHTADYCKDLAVSVTGVQSEIRKEPKPESILQVISTPVPLPKESPFVSDVKQQ
RALVQKEDHWNIVHVPSVSESQDIEEGHSETIESIEKFVSNIKVEPKIPSELIYVEEKAI
STESSIALEATEQDFALQIQEGQSVRQSVLMEEKRVIKGELSQDITKSETTTAVVSEQKM
GTLLVSESRESQSLPKELTFVVSPPKSHSLDIKHQLKSTLATAVALDQPLILADFVESLG
VVEIHEVKVRKEPKYLMFTYLITSASAPLEITIAFEGEYPQTADLRSELQAAFYSIVYRE
QNVLTSEQPGTLQIDRPQRLQVTKASTKEMLSPVVEMVRLSENVEPFTSPTSQSATVKTE
AKTSFQSVTAKEQAFVQESIHIASESKIEIQQSIQVEQQETRSVTVKSATSMTSELVLGP
LPIERSTEIAFQKEEKEEYITEALMELEKEDKEGYPVFENSLEDIKTEEHSEAKFSLIIR
YVKKVNWLFNGKCIKSGKEFKCSKEHDTYTLVITKVMKDHEGEYTCEAVGEAGKTSTSSH
LTVIPRVPPVFRQRIQNLEVNVGSSAKFECEIEEAPGVTFKWFKSGTELRHSEKCRIISR
HHTSSLEIFSPAVADSGEYTCKASNRHGSDSCSAKLTVTELFPPEFVSKPDSMTLFVGKQ
AKFQCVISGSEPMNVVWHKDNIAISLDDHYKESSDKNRYFLEILNLQHSDQGTYLCKASN
SVGTATCCTELRVVDKPSFVKSFESTTVAVGNPLRLECQVDEDTGVSIIWMRDGKKLHTT
MDCKLAFEEKIACLDIQKSKLKDTGTYTCTAANEAGSSSCSSSVTVQEPPVFVKRLEPKI
LWKQGMSSRLSCTVKGSPELHVTWFLNDKPLNSSEKHKITFKTNQATLEIIDLSESDSGN
YTCEVMNEAGCESCSSQVTVKEPPAFKKELRLVEVVKGCTAHLECEMTGTAPFEITWFKD
KNPVSSDTKYNIVSKETAAYLEIKTFESADVGDYQCCISNDVGKITTKAVAKLKDPPSFV
KKVENTTAVLGSAVKLQGTIKGSAPITVQWFKDTEIVRDDDPNITTTFENIIAVLAISNV
AINHGGKYTCQAENEAGKQKCEATVTVQEPARFVEKPPCISVTAGDSATLECKVSGSPDL
KVKWFKDGKEMAGGRKYKITFKENVAVLKILSAERGDSSEYKVEVSNRVGKEQCSCSINV
LDKIIPPTFTKMLKKVDGNVGASIQMECKVSGSQPITISWFKEGKDITTGTKYQTEMQES
TALLKITNLETSDAGVFTCHATNAAGHSETSGTISVKEPPVFSLKPQSQDVIPGTTVVLT
AAFTGTAPFMIKWFREDKEMLTGGTCFIKKETNSSSLELHALKPSQSAKYTCQVSNDAGK
VSCTAALFVKEPPKFVMKLDLTKLVLNGSLATLECKVAGSPEISIRWYKNETEIGSDDKY
QMAFTDSVATLRISSCCIEDSGDYICQASSDAGSDRCSCLVTVKEPPEFVKPFESKEIVK
GTDVVLEGTVSGSAPFEISCFKDSKQIRNDRRHIISLTKDVAALQILKFEPGDAGKYQCT
VGNEVGQTSCDFLVTMKEPPSFVQKMDNTNVLLAKDVSLQCVLKGSMPMTISWMKDDHEI
KESEHVQISFENQTAVIYISSVQLKHGGKYTCHAQNEAGSQKCTAVLTVKEPANITEQAK
SVSVTVRDPATLECRYSGTKVLKAKWLKDGNELTSGRKYKIQSSDTSSILKILSAEKSDA
GEYTFEVSNDAGRSSCEAVVTVLEPPSIIEKPESQDVIPGSKVQFNVLLSGTPPLTINWF
KDKKEVSSGIDCSVQKNDTSSSIELFFAKPSDSGQYVCEVSNDVGSDSCQATLFVKEPPK
FTRKPEKITVVKPSQLVVFECQITGTPEIDTYWFKDGNDISPSDKYKMTFVDSLARLEII
SSDIKDSGVYYCEARNEAGSESCSMDLRVKEPPVLVKPLSPLEVVNGSNAYFECLVKGTA
PFEVTWQKDSKDIKSSLKHVILQKNDSIITLDVQKCDALDVGEYQCVVANEVGSCSSQST
LSIKEPPSFVERIENVVTVLGKMVEFKCVVRGSPPLSIQWQKDESWILEDPSIQRTFENN
VATLTIPVCESIHSGKYTCQAMNEAGQEKCFSTLVVQEPPQIIEKPEVINVTAGDPVSFE
CKVSGTPELKVKWSKDGKEVIPSRQHSLSYINNVSQLKLQSVQLEDKGTYVFEVSNHISA
CQCKVTLNVLEQIIPPSFIKPLMEMEEIIGKNVQIGCKISGSLPITVEWEKDGTKLSGRT
KHKILQDENSMSLDIECLEKADTGTYTCKLANKAGSCECSGTLRVKEPPSFVLVPESQAV
IPNTTVRFKGSFKGTPPFTVKWFKDDTELICGPSCFTGLEGLSCFLDLFAVGISHSGTYS
CQISNDAGTAKCTTTLLVKEPPEFVQKLPAAKVVKMGEPLQLECKVTGTAPLRISWYKND
AILSDGGNLRMTFDNSVAVLEISTSSFDDNGVYTCEAQNDAGTKSCSTALTIKEPPSFYK
LPTPVEGLKGKDASLNCELKGSAPFEITWFKDKKQLKESRKYKFVSEGCSATLHILGLEA
SDAGEYECKATNNVGSDLCQGSVKLREPPAFVKKLSNTTAISGEEVVLLTTVKGSQPMTV
SWVQDKDHILRDGENRKITFENNEVTLKVFKADSTTAGKYTCQLKNDAGVAECTANLTVL
EPAAIVDKTDSISVTAGEAAALECTVSGTPELKPKWFKDGVELSSGKKYKITFSKMISSL
KLLSTERSDTGEYTFSIKNEVGSDSCAMQLTVLDKIVPPLFSRKLKDTQSIVGKSMELDC
KASGSAPLTISWFHNEVEIMSGPNYEITFTENTCTLKVPTLKLSDSGTYKCKAVNSAGAA
ETSASLVVKEPPSFVTTPQPVEALPGTTVTFTATVQGSTPMKLKWFRGSKEIVSGRSCEI
ALRGDTAILELHNIDKSHAGEYTCQIINDAGKENCPVNLFVKEAAHFVKKLKNLSVEMGK
SLILECTYAGSPKILVKWHKDGQEIYSSYKYNITTTESSCILECLNSDKEAAGKYTCEVS
NDAGHDICEAAVSILEPPFFIESLEPMEVTAGDAVCLKCQIGGTPEIKISWFKADGKVRS
SPTCKMEFFKGIACLKLAKVAKSDIGEYTCKAENSIGSATSSCHLTVQDVKTPPSFPKKI
TSIMQIEGQPVQFECRVAGSSPMEVSWLKDGEALRSDSEYTMSFDDNSAVLNIAKGEMRH
SGEYTCVATNSVGSASCRAKLTLQEPRYPPVFDKKLVPVDVSVGDTVELECHMTGSMPIK
VTWSKDHKDIRTGGNYKISCVENTPHLTILKADKADSGRYSCHASNDVGKDSCSTEVSVK
ERKIPPSFTKKPSTTIEDIEGKVVKIEGRVAGSQPLTVNWYKDGREIFTSDFYDVTFKSS
LAVLCIKKSQLSDSGTYVCKATNEAGTASFEVSVHITAQKVPPSFDLPLKPVTVNEGETL
TLSCHVRGSPPLKIQWMKDRRELSSSANTKITFVDGTATLEMTRVSKTDSGDYLCKATNE
AGSEFCKSKVTIKDKPGAPAPAQAAPSPPQEVKKFDNLFFIEVPKSVHIVEKGTATFIAK
VGGDPIPNVKWMKGKWRQMTHGGRISIEQKGQEAKMEIKEVTKSDSGQYRCVASNKHGEI
ECSTDLNVDEKKETTVEMVKLKKTPSKQKSPKEEKDIDIVELLRNVDPKEYEKYARMYGI
TDFRGLLQAIEFLKKEKELESGRPEGEIVGRESEEDLAKLVADLQKRMEQTEPVTVARDI
TDQTTTVKKEAVFECEIKINYPEITLSWYKGTQKLDSGDKYDIKIVGDRHILKIKDCQTR
DEGNYRIVCGPHISSAKLTVLEAEVEKPMQDVAGKEGQTCTLTCQLSVPNVKTQWFRNGK
LLEPHSRYTCAVANYTQKLSIKDVRPEDQGEYTCKYKNLETTANLWIEAEQIHFTKRIQN
IVVREHQSATFECEVSFDNAVVTWYKDTWELKESPKYTFRSEGRRHFMIIRNVSSADEGV
YSVIVRLEPRGEAKSTAELYLSGKEIEIERVPYDIPDTSIQVPEAATLTIEAESSMEYYH
YEEKMETQEYVSWAEESVVEEISCTAPRVPIEESVTRKTMGMREEARTTEFEEPEPSKPV
ELIPEVPEKAKIPVEEIVTAVTVPEPIERPSAKVPQPPVAPAPKPEEPKAVPVAEPKPEP
KPKPEIKPEPKATPVKKPESPPSKVLEEETKPKTPIQEPPKKVPAKPVEAITVPTEEPPK
KVLVEEKKPKPPVQEPPKTLPTKPDEAIAVPIAVPPKKVLVEEKKPKPPIQEPAKKLPAK
PDETIAVPIEEPPKKVLVDEKKPKPPIQEPLKKLATKPDEPIAVPIEEPPKKDVDEKKPK
PPVQEPPKKLPAKPAEPIAVPIEEPSKKVLVEEKRPQPKIQEPTKKLSTKPDETHAVPTE
EPPKKVLMEEKKPKPAIQEPPKKVSVKPEQAFTIEEPPKKEPSKKPGAPLLLATQREDLV
EEKRPKKETVAMPKKQEIVSQMEEMEPQKKDVPLFPKKDEKSLPEKKDVHLTKDEEIVPP
KKKATIPDKKDEAGVPKKKDVSPRKDEKIIPLKTDITLPSKKDEPIEYIKKDVVIPAKQK
DKIVPQKKEVTPLSKKDEATAPKKTEMLPPAKQDEEIFPQKKEVALPSKKDEAVESKKKD
VYFSAKQDEEIIPKKTEVLLPPKKEEAIEHKKKDVSYPRRKDEEHEPIKKEGPLPSNKEE
IVNQKKDVPFPTKQSDELLLRKKDVPPSPKKDDIVPQKIPKQDISQTKPHMKEMIPTQIP
EKTEEKETFSVQVVTRLQKEVVLAAEILSEKEETEEIFLKEEIKHLQKEASLKPKLEEKE
DILPKKKEVIAMTKKEEVIMPKKKEIPLLAKKDEVPQKKEVTPTKVAEPERKPSPDKIPE
TPVSVKEVAPPKVEKKPSPEPERKKEPLPEPKAKTVSPEVKEVDKKAEDKLISKPKEEKT
IPTKVPTPKEPEKPKPASKEEPVPIVLPAEDGEKEPVSAPGAVKKGKVLKIKEEEGRFEI
PTLKKAKRLSKDKDEDPEMVKLKKVLKPEEEEYKESPKVYAEARREVVITESYEAEMHFE
TYEATKRDVKIQPEIDKKRSAEPDRAPPEIKPESEVEDKAKKTAVARVPKKVTPEEPGLA
LKKVKKLPLDTGEPESVKLKPFEKPVKTHPETEKDTKKDEKGREPATFDKSREPITFQKG
ELPLKDEKTKEPDVPVKKEKPSIPDKKEPDEVAVKAVTRPAKDEVPTEPKEKLVKGKGKI
PSKDQDPEKVQLKPFTKKPSAGSPKEKEAAEPKDRKPIELSPLSRAPKDDIKKEPSIPTK
KIDSQETPDKAKEVEKISTPVPVEDKTTPPKKVTPVKKITPKEDEKKPIVIKKGVLPKEA
EEKEEIKLKPVERTKSGIEPEKIPSPKVEKTKPAESVPVQRKPIDDLTKTPKTISPKDST
EAVILKKVPHKISPKQEKSEETPQISGDDKIPVLKELSPGAVELRKVSTQFEEEVFEEEF
EYEAEYEDEEEEAWGWELASRDSYGSEGSEEQYLEEGALETPGMPGGRREGKPKEEAGRG
RGLKPKQTPSPGEGGKGRGLKPGAGGDKPPGDSPFGFQLKAVPLKFVKELKDIVLQEAES
IGSSAVFECQISPSTAITTWMKDGSNLRESPKHKFTSDGKDRKLQIIDVQLSDTGEYTCV
AKLGNKEKTSTAKLIVEELPVKFTKTLEEEMSVIKGQPMYLTCELSKDRDVVWKKNGKEL
KQIAGKVQVNVIGLQRSATIQDTNDDDAGVYTCECEDIKTQANVKIIEIIRDWLTKPLRD
QHVKPKATATFKCELYKDTPNWKWFKGDEEIPTDPTNKTDVKKDGKEITLTVKNAQPDDI
GEYAIEVEGRRYTAKLTLGEREAEILKPLASVEVVEKGEANFDTEISEDDIPGEWKLRGQ
VLTRSPTCDIRAEGNKRFLTLKNVQLDQAGEVSYQALNAVTSAMLTVKEIEMDFTVPLRD
VTVHEKKQAKFECTITKDVPKVLWLRGSDIVTSDQKYDIIDDGKKHMLVINHCEFEDEGE
YTIEVLGKTSTAKLTVEGMRLKFVSPISDQTVKEGKTARFELELSHDSVPVTWYKNETKL
HPSRTVLTHVDGKKHILEIKDVTLDDTCQIKAEAKGMSTTANLTVLEGDACFTVKLQDYT
AVEKDEVILDCELSKDVPVKWFHNETEIKASKMVAIKVEGKRRILNIKKVEDKDKGLYVC
DCGTDKTSSTLNIEARDIKVVRPMYGVELFDGETARFEVEISEDDVHGQWKLQGEVLSPS
PDVEIIEDGAKHTLTLYNCKVSQSGEVSFQGANAKCSANLKVKELPISFVTPLADVHVYE
KDEARFECEISRQAKSFRWLKGSQEIKTDDKFEVLQEGKRHILVVKAAAYEDEAKYMFEA
EDNRTSAKLVIQGIRLEFVRPIKDVTVKERETAEFSIELSHEKVQVTWYKNDVRLHPSKV
VHMSEDGKIHTLSFKEVSIDDTSLIKVEALGKTCEAMLTVLEGEPYFTTKLQDYTAVEKD
EVVLMCEVSKSSAQVKWFKDGNEITPSKNVLIKADGKKRILTVKKAEKGNIGEYVCDCGS
DKTAAKLNIEERDIKIVRPLYSVEVTETETARFETEISEEDVHGHWKLKGDALHQSPDCE
IKEEGTKHMLILYNVRMDMAGAVDFSAANAKSKAQLRVKARVIGLLRPLKDVTVTAGETA
TFDCELSYEGIPVEWFLGGTKLEPSDRVVTRAEGRSHTLTLRDVKLTEAGEVKLTAKDFL
TQAQLIVNEPPVEFTKPLEDQTVEEEATAELECEVSKEKAEVRWFRDGQEIRKTKKYDMV
ADGCKRKLVIHDCTLDDSKTYTCDAKHFKTSAFLNVEPPYVEFTKPLHDVEVKEKESARF
ECEVSRESAKVRWFRDGNEIRKGKKYEMISEGVKRILIISKSVFDDEAEYECDARTSKSS
GMLTVVEEEARFTKNLANIEGTETDSVKLICEVSKPSAEVTWYKGDQELPEVGRYEHITD
GKKRILIIKGLRMDDAGEYHCKLPTSQTTGNLRINELAAEFIARPQNQEVVEGEKAQFVC
SVSKDTYEVKWLKGNTELQSDDKYEIISEGKKRVLIVKNCELKDEGGFVVLIGTTRASAD
LTVLEKLRIITPLKDTKANEGQETVLNCEVNTEGAKAKWLKNNETLFESSKFIMVQKDNV
FSLRIKDTQKSDEANYTITLTNQRAEQAKSSANITVHEEDLRIVVPPEDVDTQEKKAISF
TCKVNRQNVTVQWMKAGQEITLSKRILYRVDKEKHTLTIKDCSLADEGEYTVIAGPDKAT
AELIISEAPTDFTAQLSDQTITEFEDAEFSCELTKEKADIKWYRDGREIREGPRYQFERD
GKTCRLRIKECRPDDECEYACGVDDKRTRARLFVEETPVEIVRPPTDVFEPPGSDVVYEV
ELNKDRVEVKWLRNNMTIVQGDKYQMMSEGKIHRLQVCEIRPRDQGEYRVIAKDKDARAK
LELAAVPTIKTLDQDLVTDAGKPFVMGVPYNAYPLAEAEWFYNDISLPKDNIHTSIDRTE
YRLKDPKKSEEGRYKIIVQNKHGKGEAFINLKVIDVPGPVKNLQVVDTADGEISIAWEEP
ESDGGSKILAYVVERRDVKRKTWTLATDCADSTEYTVTGLQRDSKYLFRVCARNRVGSGP
NVETDKAVQAKNKFDVPDAPQNVIVGNVNKFGATVSWEPPLFDGGSEITSYIIELRDRTS
VVWAPVMVTKPHERSAIINDVIENKEYIFRVKAENKAGIGKPSAATNPVKIMDPIERPSP
PLNLTHSEQTKDSCLLTWETPLKNGGTAITGYIIERCEEGTDKWLRCNARLCPDLLYRMS
GLKFGKKYSYRVIAENAAGQSDPSNIVGPVLADDPHYAPTLDLSAFKDGLEVFVPNPLSI
RVPITGYPVPTAKWTFGENALTAGDRVSMVTKSTFTELVITPSVRADKGTYSLTLENDVA
SVSGEIEVNVIASPSAPKDLKVAEVTRKHVHLMWEAPEHDGGSPITGYQVEKREVSRKTW
VKVMSGLQDQEYTVTDVVEGKEYLFRVIACNKCGPGEPAYIEDPVNVSSPATVPDPPENL
KWRDKSASKIFLSWEPPKWDGGTPIKGYIVDKCQRGTDKWEPCGDPMPELKFEVTGLIEG
QWYAYRVRALNKLGASKPCKSTDEILAVDPKEPPEIQLDAKLLAGLTAKAGTKIELPADI
TGKPEPKVKWTKADLVLKPDDRITIDTKPGHSTLSIAKTKRDDTATYIIEAVNSSGRATA
TVDVNILDKPGPPAAFDISEITNESCVLAWNPPRDDGGSKVTNYIVERKAVDSEIWYKLS
STVKQTTYKATKLVAFKEYIFRVYAENQFGIGAPAEHAPIIARYPFDTPGPPYKLEPSDI
AKDAVTLSWYEPDEDGGSPITGYWVERYEPDHDKWIRCNKLPIRDTNFRVKGLPTRKKYK
FRVLAENLAGPGKPSKETDQILIKDPIDPPWAPGKPTVKDVAKTSAFLQWTKPEHDGGAK
IESYIVELLKSGTDEWVRVADNIPSLEHFLKGLMEKQEYSFRVRAVNVAGESEPSEPSDP
VLCKERLNPPSPPRWLLVVSSSRNSAELKWTAPERDGGSPITNYIVEKRDVRRKGWQAVD
TTVKELKYTVTPLNEGSLYVFRVAAENAVGPSEFCELEDSVLAKDTFGTPGPPYNLTITE
VSKTHVDLKWEAPQNDGGRPVLRYVIEKKEKLGTRWVKSGKTSGPDCHYRVTDVIEGTEV
QFQVSAENEAGVGHPSEPTDIVVIEDPTGPPSPPQELHITEAARDHICIAWKAPEKNGGS
PIIGYHIELCEAGTEKWMRVNSRPVKELKYRAGDEEGIVPEKEYTFRVRAVNSVGASEPS
DISENVFAIDSDCSPTLDFQTKDLVVVEGEKMHLPIPFRAVPSPKITWHKDGNEMKADDR
TFFRAEYTSCHLEVPSCLHADAGQYKVTLENRNGATSGTINVKVIGLPGPCKDIVASEIT
KSSCKVSWEPPDYDGGSPILHYVLQRREAGRRTYVKVMSGENKLSWPVKDLIQNGEYYFR
VRAVNKIGGGEFIELRNPVIAEDQKQRPDPPVDVETHNPTSESVTLTWKPPMYDGGSKIM
GYILEKMMKGEENFQRCNDFLVPVLSYTVKGLTHEKQYQFRVRAENAAGVSDPSRSTPLI
KATDATDRPKVFLSGSLQSGLAVKRGEEIRLDANISGFPYPQITWMRNNATIWPEPLKKR
PERPIKKKKEKEEKKEEGAEKKEADAEKKEEDKEAKEEDKEKKEEKKEEEKEKEKEVEEP
EEPEEEYHPSLNERLTIESKRKGESYIIIKDTIRGDHGVFTIKVENDHGTASASCEVNIL
DTPGPPVNFKFEEIRKNSILCKWDPPLDDGGSEILNYILERKDNSKAELGWITVTSILRG
CKFLVPKLIEGKEYLFRVTAENKYGPGKPCITKPVIARNPFDPPDAPEKPEIKDVTASSM
CVTWLEPNDNGSAIEGYWVEKREINSTHWARVNRTMVPDLEINVEGLLEGLTYIFRVCAE
NIAGPGKFSPPSEPKTAQAPIMPPGPPIPRIVDTSDYSIDIEWDPPADNGGAEVFGYHVD
KLVAGTKDWSRATERPHKTRTFTVYGVREGAKYIVRVVAINCAGEGEPGLTDAVIVRNPA
EVPVIELDISVRNGVVVRAGEMLRIPAHVTGRPPPSLKWTKDDGDLEKDRMEVEEAGQDS
TVVIKTTKRSDHGKYQIQAANPSGIKSAWTRVEVMDVPGPVLDLKPVVVTRKLMMLNWSD
PDDDGGSDVTGFIIERREPKMHTWRQPIETPSSKCEIVGIIEGQEYIFRVVAKNKYGCGP
PVDLGPIRAVDPQGPPTSPEKFHYTERTKSSVTIEWRPPRNDGGSPIIGYIIEKKRQDQP
AFQRVNPELCTVQIMTVDNLDELHMYEFRAKAVNAFGESEPSITMTVVIQDDEVAPSLRM
LKHFKGDLIRVRKNEPIEMPAEVTGLPMPKIEWLKDDVVIEKPTEKLLFETKEIDRVTSH
TKLSIPGVTRLDKGTYTVTASNRLGTLSHSVTVEVLDRPTPPRNVAVSSIKAESCNLSWD
APLDIGGSELTNYIVEMKDLNVEDPEKAEWVQVTKSIIEKRYGVWNLVTGGNYKFRVKAE
NKYGISEACETEEVEIKDPSALPGPPEKVTIAERSKTHMLLTWEPPKDSGGSMITGYWLE
KREKGTSYWSRVNKILVSKRGMKGWEYQVTRLFEGVEYEFRAMACNSAGIGPPSAISESA
VADDPLTPPSMPAAPEIADKTKHSVTLAWTPPAKDGGRPIKGYIIEIQDEGTSEWARVND
AENLHPSTVFTIPNLPELKKYRFRIIAVNEIGESEPSPRTSEVRIEDIKTAPKIFMDISA
DELLCVRAGTPFKIPATITGRPAPKVTWEFDGKAKTEKKDRLHILPVDSQVESTDTTSVV
TVPVSLRSHSGRYTITAKNKSGQKHVNVRVNVLDVPGAPKELKVTDVTRTTMRLIWKLPD
NDGGERIKSYFIEKKAVNGKAWTVANATCASMAFVVSNLLEGQDYFFRVRAENRLGFGPF
TETTEPVRARDPIYPPDPPTKVKINLVTKNTVTLTWVPPKNDGGAPVKHYIIERLSWDTS
GPQKETWKQCNKRDVEETTFIIEDLKEGGEYEFRVKAVNEAGASRPSVTAGPIVIKDQTC
APSIDLREALEGAEGFDVNIVARIQGCPFPSLVWHKAPQDKPDDKVPVQYDKHVNKLVSD
EKCSLFIQQSKRDDSAMYTLTATNSLGTATKSIKLSILGRPGVPVGPIKIGEVFAERIGL
SWNPPADDGGSKITNYVVEKREENRKTWVHVSSDPKECQYIVQRLTEGHEYEFRVMAQNK
YGVGPPLYSEPEKARNLFTVPGQCEKPTVTDVSAESMTVNWDEPEYDGGSPVTGYWLERK
ETTGKRWTRVNREPIRIRTLGVSHIVTGLLEGAIYQFRVIAINAAGCGLPSLPSDIVACR
DPIAPPGPPTPKVTDCTKSTVDLEWIPPLNDGGSMITGYFVEYKQEGQEEWEKVKDKEIR
GTKFVVPGLKELGLYRFRVRAVNAAGVGEPGEVADVIEVKDRTIPPEVDLDATVKEKIVV
HAGGVIRILAYVSGKPAPEIIWNRDDAELPKEAAVETTSISSALVIKSCLRQHQGIYTLT
AKNAGGERKKAVIVEVLDVPGPVGLPFSGENLTNDSCKLTWYSPEDDGGSAITNYIIEKR
EADRRGWTSVTYTVTRHNAVVQGLIDGKGYFFRIAAENIIGMGPFTETAAPVVIKDPLSV
PERPEDVEVTAITNDSISVAWRSPKYDGGSDITSYVLEVRLIGQDNFSRIAKEDKLMDRK
FTHAGLKEGSSYEFRVSAVNQIGQGKPSFSTKPVTCKKEFEPPNLDLEFRDKLVVRVGET
CIIQSRYTGKPEPTIKWFKNDEELQANEEIALTTAKNRLSLTIEKAKRDHSGKYMVVLEN
SIGTRKGICTVNVVDRPQPPEGPVIFDEIYRNYMVISWNPPLDDGGAAISNYIVEKRDTN
RDLWMPVTESCTRTSCKVPKLIEGREYIIRICAQNIHGISDPLLSAETKAKDVFKVPDAP
QAPVVKEIYKDTALISWLQPADGGKPITNYIVEKKETKANMWARAGKDRIFPNTEYWVPD
LLKGCEYEFRVMAENVIGIGDPSPSSKPIYAKDPIVIPSPPVLPVAIDKTKESVTLSWQP
PKDCGRGKIFGYLLEYQKAGDEEWLQVNQTPDSCPSTTFKVINLEDGALYRFRVKAVNAA
GESEPAYVPEPVRAQDRFEPPELQLDLGMPRELKAMAGTHINIMAGIKGMPFPKVTWKKN
EADVPTRAEIETSGTTTKLEMRYCNRTDCGDYTLTVENPAGSKIATCTVLVLDKPGPVQH
LRVSDVRSDSAQLSWKDPEDNGGARITNFVVEKKDAASPQWVPICSSSKKRSMMAKHLIE
GTSYMFRVAAENQFGRSEYVETTKAIKAMNPLFPPGPPKDLHHVDADKTEVWLQWNWPDR
TGGSDITGFLVEYQEEGEKDWIVFKTVSIPECHVTGLEEGKTYRFRVKTENAIGLSRPDT
TVPVLCQEKLVPPIVEVDVKLIEGIIVKAGSTIRLPALMRGLPVPTAKWVIDGEEIKSEG
NTKIDTDNFSTVLSIADCTRNHTGIYILTVSNSAGSKTVSLNVTVLDVPAAPIGPVNILE
VTPDSMVIDWRPPKDDGGSPVMNYIVEKRESNKETWGGVSSGSTSTRLKISRLQQGVEYV
VRIRAENKMGIGAALESAPTVARHQFEAPGHPGKPVASDLSEDALTLGWTMPLFDGGSPI
SGYIIERRHKGGKWIRVNKTPCKELRYRVLGLFEGNEYEFRVFAENIAGFSGPSPVSDPA
KPCRPITVPGPPVNPKVKDYSCTYADLVWIKPTKDGGSPVLGYIVECQKGGAEWEKVNKD
DLIKQCAYRVKGLTEDTEYRFRVKAVNMIGEGETREIPESVIAKDIIIPPEIEMDATCHE
RVTVRVGHNINVVGYVKARPDPEITWSKGESILERDKRTMLTNNFPVVQMRIKEATRADH
GKYVLKAVNEAGEASATITVNVLDRPGHCQNLKMTYVTKNSCMVSWDAPEDNGGSEITNY
IVECREPSIRTWAMISSDCTNRMVKAKLMENHEYLFRVSAENKCGPGPATETKTPILAID
PLQKPGEPENFHVGDIGKNFVFLKWRKPDYDGGSPNLGYYLERKAKDAEAWEKLHEGVLK
ETFFMVDKCVENHIYQFRVQSTNDGGESAWVSTSDIVVKEEIQKPVLDMKFVGTIVVKAG
ESVRLEAGLRGKPQPTVTWVKDKATGDNPRISIDTGHDYSKFLLTKTKRSDTGKYVVTAT
NPAGSFTAYANVTVLDIPGPVRDMKISGISTDKCRVAWDPPEDDGGCEVDSYIIEKCETR
RMVWSTYSASLVTNYCNVTRLVEGNEYIFRVRAENKMGTGPPMESRPIIAKTQYNRPGPP
DAPEVTKIGKDEMTVVWAPPENDGGKSITGYILERKEKRAVRWVPVTKSPISERRMKVTN
LIPNHDYQFRVKAENEVGLGEPSKASRPITAKDPIEPPGPPGSLKVVDSTKTSITLSWAK
PVYDGGAPVIGYLVEMRDKVEMEGEQVRDPEEGWKKCNTSGQLVLTEYTISNLDERQEYE
FRVSAQNQVGMGRPANVKDAVSPKEVHEHPEIDLDASLRKGLSVRAGCPIRLFATIRGRP
APKVTWKRIGVDNVIRRGHVDQIDTMTFLVIPESSREDSGKYSLTLSNPSGEKAVFVRVK
VLDTPGPVGGLDATDITKTSCQLAWLPPENDGGSPILNYIVEKREVDRKTWTNCTNDLKK
TSFKITNLTPGIEYYFRVMAVNKYGIGLPQDSPKSYLATDPKSEPDPPKKMDVLEITKNS
ATLGWLKPLRDGGSKINGYIVEYQQDGQPEDKWTSYSVVKDLTIVVAGLKENTKYRFRVA
ARNAIGCSLAREAEGIFEVKEQLMAPKIIVSDVVTARAGSKLIVDALVSGKPAPVTKWKR
GSDDIVTSDRVVIQKTPTTSLLMVKDVTRKDSGYYSLSAENSTAKVNQIIRIIIMDIPGP
PQGPLQILEVDVDACTLAWDTPAEDGGSNITNYIVEKCDVTRGDWVTAVSCTKTSCRVGK
LTCGKEYGFRVRAENRFGISEPIYSEKMIARHPFDPPSEPLNCCVNKVSKEFVVLSWEKP
VNDGGSALTGYFIERKERNSLLWVRTNEVLVRSTEYTCSGLIEGLEYTFRVSAVNKAGQG
KPSKQTDFITARSPVDPPGKPEIIDVTKSSVSLVWSRPKHDGGSKLIGYYVEFLKLKEDK
WVRVNSNSQNVPKEEYIVPGLEEGAQYKFRIIAKTAINVSVPSEESDVIPIIAEHVPPRV
EISLEMKNLIVVKAGANVCLEAEVYGKPMPKVVWKKDGAPLKLAEGMKMTQKVHHLSLEL
FSVTRKESGEYTITAENPSGSKSANIKLKVLDKPGPPASVRISHVFADRVKLRWEPPLAD
GGSEITNYIVDKRETSRANWAQVTANINGQITDCSVEKLIEGHEYEFRISAENKYGVGDP
IVTSSVMAKNPFDVPGPCEPPVITNVTRDHMTVTWKAPANDGKATILGYMVEKRETQDLN
WVKVNRRPVIDRTIKAGGLTEGTEYEFRVIALNKAGLGKPSDPSSGVLALDPVYPPGPPA
FPKVVDSTHSSISLSWTKPAYDGGCEILGYLVEFKRADAEEWMKCNVPKNLQATKFNVTG
LIDNTEYQFRVSAVNKIGFGEPSEVPEKHLAKDILLAPEAELDADLRKALVLRAGVTMRI
YVPLRGRPAPKATWTKVNANLKERQGLMIKTTEWDTFLYCEDINRYDAGKYVLTLENSSG
TKSYTIVVKVLDTPGPPVNLIVKETSKDHVSITWDAPLIDGGSPVKSYVVEKRLAERKAW
TCVAPECPKTSFRITNLEAGQAYCFRVLAENIYGIGEGCETAGPVKASEQPGPVAEFKSM
EITKNSCTLGWKKPISDGGSHVVAYALEICEGEDKWKLLMKSKVTQYTIGDLVEGKEYSF
RVKAINESAEGPPTELTILAKDQIVPPNCDLKGLPDSSYVAKEGTTVRLNIPITGIPAPA
VIWKKGDVTLSDSGRISVESTTTNTVLLIRDCHRGDAGKFTIILRNSAGTKEAAIDIKVV
GKPGICSGPIKFDEITAEAITVEWGPPKDDGGSEVTNYFLEKRHSTANKWVTVASAIQKN
SMRVTRLHDGTEYIFRVCAENKYGIGEFLRSDPVLAKHPFNAPGAPAPPVVVSIRHECAM
LTWSDPNDTGGSPITGYYVEFKDRNSLMWKRASKTQLRVKECRVTGLVEGLEYEFRVIAI
NVAGLGKPSRTTESLVALDPIDPPGKPDVINVTRNSVTLMWTAPKYDGGHKLTGYMVEKL
EHPGKTWMKANHVNVQSCAYTVTDLQEGCTCEFRIRAKNAAGAISAPSETTEPLVCKDEY
EPPTITIDPEMKDGVTVKAGGTIVITASSILGKPPPTAVWSKAGREFKSSDIVQISSTPT
SSTLSIKYASRKNTGEYTITASNPFGIKDEKVKVKVLDVPGPPGPIEASSVSAEKCTLTW
LPPEEDGGCSIKSYILEKRETSRLLWTKLAENVMDCRYVASKLIKGNEYIFRVSAVNQYG
TGDVTQSGPVKMVDSFGPPGPPSKPEIDNVSKNAVTISWKRPTVDGGSDIRGYIVERKER
RGMRWVRASKKTVSDLRFKVSGLSEEIEYEFRVTAENKAGFGEPSEPSQPVMTKDIAYPP
GPPSNPRITDTTKTTATFNWGRPFYDGGLDVTGYIVEHKKEGDDDWVQDTTIPLRITEFV
VSNLQSGGKYHFRVSALNSEGLGEPSEVEQVVELVDREEVPDFELDAELRKTLVVKSGAS
IRIFVPIKGRPAPEVVWYKENVPLKGRAHIDTTESYTLVVIPECTRYDAGKYVLTLENVA
GKKTGFVNVRVVDTPGPPVNLKPREITKHSITLQWEIPLIDGGSKIKNYIIEKREATRKA
YSVITTNWQKCSYKIPDLEEAAEYYFRVSAENEMGIGEPAETPDPIRASQAPSAPDDLIV
TDVSKDTATLAWTKPKHDGGSRITGYVIEAQLKDSDQWAHVTTIKALDYIATELVENAEY
VFRIFAVNSSGRSEPRESRPVVIKEQTTAPEFDLRSIYQKTVVAKAGDNLKVEIPVLGRP
RPLVVWKKEDQELKQTQRINIENTASSTILNINEIKRKDGGQYSMTGKNILGTVTENITV
QVHDIPGPPTGPIKLDEVSCDYVLISWEAPENDGGVPINNYIVEMRETTGTSWMELAATV
IRTTFKAARLTTGIEYQFRVKAQNRYGVGPYITSGPVVAAYPFDVPGQPGIPQIVAFTKD
AMTISWNEPSSDGGSPILGYHIERKEKNSILWQRISKAVVVGNMFKSSGLMDGIAYEFRV
IAENLAGLSKASKPSEMTYALDPVDPPSQPVALNITRHEVTLQWTKPEGDGGFSITGYTV
EKRELPNGRWLKANFSNILETNFTVSGLTEDVSYEFRVLARNSAGAVSKPSKPSEVIVCR
DDIEEPKIDADASFSSVVVVKAGDIFKLDAHVTGRPIPSIVWTKDGKELEDTAKMEIKTL
DFYSCLINKDSLRRDGGAYTLTASNPGGFAKFVFNVKVLDRPGPPEGPLHVTDMTVEKCV
LSWLPPLHDGGGKIEYYIIQRRETSRLTWTNVATDLQVNRYKVTKLLKGNEYIFRVMAVN
KYGVGEPLESEPAVATNPYVPSDPPQAPEVTAITKDSMVVCWGHPEYNGGSSINTYIIER
RDKTGLRWVKCNKRTVTDLRFKVSGLTPGHEYEYRILAENAAGLSAPSPSSPFYKACDTI
FQPGPPGNPRVLDTTKSSITIAWNKPVYDGGSDITGYIVETCLPEEDEWTIVTPMAGLTA
TSFTITNLTENQEYKINISALNCEGVGEPASVPGSPKAEDRLLPPEIELDSDLRKVVNIR
ACSTLRLFVPVKGRPAPEIRWSREKGEPLDRASIEITPSFTTLLIENVDRFDGGKYMLTV
ENSSGTKTAFINVRVLDTPGAPQNLTIKEITKDSVSLIWDPPVIDGGSRIRHYIVEKRES
TRKAYSIVNASCPKTSWRIGDLQEGNLYFFRILAENEYGVGLPVETMEAIKISERPLPPG
KVTLKEVTSNSVTLSWEKPDHDGGSRITGYIVEMQGKNSDKWTQVMTVKVTEAVVVGLTQ
GEEYSFRISATNEKGISDPRPLSVPVIAKDVVIAPAFKLLFSTFSVLAGDDLKIDVPYVA
QPKAAVVWQKDGISLKETTRVNTEVAERHLYLLLKEATRDDVGKYTIKITNSAGEATADI
NVIVLDKPGPPTGPIKIEEVTADSVTLSWQPPEYEGGCSINNYIVEKRDTSTTNWQIVSA
TVARTTTKAARLKTGCEYQFRIAAENRYGKSSVIVSEHVVAQYPFEIPHPPGIPAVQSAT
KESMVVVWNKPSSDGGSKILGYHIESKEKNSLLWVKQNKTIIPDTRFKIGGLEEGIEYEF
RVYAENIVGLSKASKVSEIQVARDPCDPPGKPEAVIVKRSSVTLRWTPPQFDGGIKITGY
VVEKKELPNGRWMKASFANIIETEFVVSGLVEEQQYEFRVIARNAAGVSSVPSDSTGAIT
AKDEVDPPQIDLDAKYSQNVVVNAGESFRIDAGILGKPIPSVHWIKSGEELTNTARLEIK
NTDFTTTLSVKEAIRVDGGQYTLLLKNVGGEKSVIINVKVLDRPGPPDGPISIYGVTSEK
CCISWKTPLHDGGAEVSHYIVERRETSRLVWTVVELKVQTLNLKITKLLPGNEYIFRVIP
VNKYGIGEPLESDPVIAANPFVTPEAPSNVEVSNITKDSMVITWERPTNDGGSAITGYIV
EKRDKEGVRWTRCNKRVVSELRFRVTGLLEMRSYEFRVSAENAAGVGKPSPPTVYFKAAD
PVFKPGPPNNPKVAYVSRASVVLHWSKPIYDGGCEIQSYIVEACEVTSDEWVMCTPPSGI
TETRFEAKKLLEKHEYKFRICAVNKIGVGETADIPGSVIIEDKLEAPDIDLDADLRKMIT
VRAGGSLRLFVPIRGRPTPEVKWGKTEGEINEAAQIDITSSFTSLVIENVNRFDSGKYTL
TLENASGTKSAFISVRVLDTPDMPANFRVKEITKNSVTLTWEPPLLDGGAKIKSYIVEKR
ESTRKVYSAVTTCNKMTWKIEPLEEGSIYFFRVLAENEHGIGLPAETPEPLKISEVPQPP
GKVSVVDVTRKSVSLKWEKPEHDGGSRITYYEVEMQAKDQDKWSLCAQVKALDTVVTNLA
QGGEYIFRVIAVNDKGKSDPRLLASPVVAKDLAIEPTVRTKLSTYSVQVGYDLKIEARIS
GHPKPTITWNKDGSALKQTTRVNVADTAHHTTLTIKDATREDGGMYNIVVANVLGQQEAT
VEIIILEKPGPPTGPVRIDEVSAESITLSWDPPTYTGGCQISNYIVQKRDTTTTNWVVVS
ATVARTTLKVGNLKTGAEYQFRIFAENRYGKSYGIDSDPVLAQYPFKEPGPPGTPFVSAF
NKESMVVEWHKPVSDGGSAILGYHLERKEKNSILWTKINKILIQDTRYKTSPLEEGIEYE
FRVYAENIVGIGKCSKTSEGCIARDPCDPPGTPVPVIVTRHSVKLRWTPPEYDGGSLVTG
YVVEKRDLPEGRWMKASFANILETEFTVTGLIEDCKYDFRVIARNGAGSVSRPSESTGSV
TAKDEVEPPTYEVASEYSQILTVNAGDTFSLEASVLGKPIPAMQWFKGDVEVENSARAEI
KNTDFKAVLVVKDAIRIDGGQYTLHLSNVAGSKSVSFNVRVLDRPGPPEGPLTVSGVTNE
KCSLSWLPPRHDGGSSISYYVIQKRETSRLAWTVVSGDCGATMFKVTKLLKGNEYIFRVM
AVNKYGVGEPLESRAVIMRNPFVAPGPPQDLEITNISRDSMTVCWTRPESDGGNEIVGYI
VEKRDRAGIRWTKCNKRRVTDLRFRVTGLTEDHEYEFRLSAENAAGVGQPSQPTVYYKAC
DPTFKPGQPTNAHLVDTTKNSVTVAWSRPIYDGGLDIQGYVVEISKADEEEWITCTPPTG
LNDTKFSITKLTEHQEYKVRICALNKLGVGEPVPIQGSVKPVDKMDAPEIELDSELRKGI
VVHAGGSMRINIPFKGRPIPEINWTKDDGDLPDKAQIDKGPDFTHLTINICDRNDAGKYT
LTLQNSAGTKSAFVSVKVLDTPGAPQNLFVKDITRNYVTLVWEPPLIDGGSKIKNYIIDK
RESTRQGFTNITTKCSKTSFRVGDLTEGGIYYFRVMAENEFGIGLPVETEESVKTADPPL
SVGKVTLTDVTKTTASLSWDKPDHDGGSRILGYYIEMQPKGSEEWIVATVCKTCEGTVAG
LSSGQEYLLRVLAYNEKGKSDPRPLASPVIAKDVTIEPSFKLTFNTYSVQSGEDLKVEIP
FKGRPTPKIGWMKDGQALKETTRLNVSSTATSTVLKIKEANREDSGKYTITATNNIGTVT
EEVAIIILDKPGPPTGPVKIDEVSATYVVISWEPPVYTGGCQINNYVVEKRDTTTTNWQT
VSATIARTTIKISKLKTGSEYQFRVFAENRYGKSGSIDSTPVVVSYPFTEPAAPGAPFVS
SVTKDHMTIEWKPPSNNGGSPIIGYHLERKEKNSILWTKLNKLLITDTRLRTNGLEEGIE
YEYRVFAENIAGISPSSKVSESVVARDPCDPPGTPEAIVITRNLITLQWTKPQYDGGSVI
TGYIIERKKLPDGRWMKASFTNIIDTQFTITGLHEEQRYEFRVIARNAAGILSVPSESTG
PITAQDEIEAPSVSMDSRFKDVIIVKAGDSFSIDSDIAGKPLPDIVWLKDGKEIDSATPR
MEIKSTITRTVLTVKDCIRVDGGHFVLSLSNVGGTKQVPINVKVLDRPGPPDGPLKVTGV
AAEKCYLHWSHPSHDGGASISHYIIEKRETSRLSWTVVEPKIQAISYKVTKLLPGNEYIF
RVMAVNKYGIGEPLESEPVLAKNPFNKPGPPSTPEASAITRDSIVLTWERPEDDGGSQID
GFVLEKRDKEGIRWTKCNKKRLNDLRFRATGLTEGHFYEFRVSAENAAGVGTPSEPSEYY
KACDATYPPGPPNNPKVTDHSSTTVSLAWSRPIYDGGAPVSGYIVEAKDINEDEWTVCTP
PTGVQATHFTVKKLKENAEYNFRICAVNIEGAGEHVDVPGSVIAAEKLEAPEIELDADLR
KCVTVRASATLRLFVTIRGRPEPEVKWKKADGTLPERAQIEVTGSYTGLVIDNVNRFDTG
KYVLTLENNIGSKSAFVNVKVLDSPSAPVNFEVKDVKRDSVQLQWEPPQIDGGAKITHYI
VEKRESKRLAFTSITNNCVRNSIRVDDLQEGGLYHFRVLAVNELGVGLPAETTEAVKISQ
APLPPGKITVIDVTRHTVTLSWEKPDHDGGSKITGYMVEMMTKGSDKWTACVTIKALEAT
IEGLTTGEEYSFRITAINDKGKSDPKPLGAPVVARDITIEPIIDLMFNTYSVKAGDDLKI
DVPFRGRPSPEVTWKKDGHSLKQTTRVNVLTSKTLSKITIKDATREDAGKYEITLTNTFG
VKSAEISVIVLDKPGPPGAIKVEEISADFISLSWDPPIYDGGCQINNYVVEKRDTTTTAW
QIVSATVARTSIKVSRLTQGTEYQFRIAAENRYGKSHAIDSAPIVAQYPFTPPGPPTSLQ
VSHATKSGMLVTWNRPASDGGSPIVGYHIECKDQSSILWTKMNRGLITETQFKVTGLEEG
LQYQYRVYAENIAGIGPCTKACDPVSARDPCAPPSQPRVMNITRTSVSLSWTKPEFDGGA
KVTGYIVERSELPDGRWLKCNFTNLQETYFDVTGLIEDQRYDFRIIAKNAAGLFSEPSES
TGPVTVKDDVDPPRITIEDKLRQLVVIKAGEILRIDAEISGRPIPVISWAKDGKEIEAKA
RFEISSTLTSTTLIVRDAIRRDSGQYVLTLQNVAGTRSLAVNCKVLDRPGPSSGPLDITG
LTAEKCTLTWGPPQENGGAEIQHYIVEKRETSRLAWTLVYADMKATTCKVTKLLKGNEYI
FRVRGVNKYGTGEALESDPAKAMDPFTVPAAPTDVEVTSVTSEAMTICWERPISDGGSSI
SGYVIEKREKSGLRWVRVNKKPVYDLRVKASNLREGCEYEYRVFAENAAGLSAPSVPCPL
TKAEDPLFLPSPPAKPKIIDSTKTSVTLSWNKPLFDGGSPVTGYMVEYRNTNDDDWTVGV
NNTKSTEFTVVGLTSGTEYVFVVRSINKIGPSEPSPETDPQVAKEREDEPVFLISNEMRK
TLVVKDGSSFTLRVPFKGKPVPHVMWNKPDVDLRVRASIDTTDTCTSVTIEQATRDDSGK
YTVTLQNVAGTATLTLSVKVLDSPGPPAHIEVKEVTKSSATITWDTPDNEGGAPVKNYLV
DLREATKMGWSRISNSCPRLTYKVTNLQEGGVYYFRVTGENEYGVGVPLETKEGTKITEK
PSPPPKLGVTDVTKESVSLAWLKPEHDGGSRITNYLVEALEKGQQKWIKCGSTKSTHFVV
DGLRENAEYYFRVRAENHAGLSDPKDMVLPVLVKDQLEAPEINMKDFQHNTAYVKAGSNL
KIEIPLTGKPLPKVSLSKDGQVLKSTMRFNFDVTTDSLIIYLRESVASDAGRYDITASNS
NGTTKSFVNVVVLDRPGPAVGPVEMCDITEDSVSLKWLPPAYDGGSPITNYIVLKRETTT
ANWIEVSSAVARCTIKIMKLNTGVEYQFRIKAENRFGISEHIDSQTVTVSLPYTLPVAPS
QPWVSAVTKESIVVNWKEPSSDGGSHVFGYHLQMKDRNSILWQKVNTTVIRATHFKVTNV
NAGLIYEFKVAAENAAGIGPISKSSDPVLAIDACEPPNSVRVTDITKNSISLAWQKPSYD
GGSKITGYLIEMKDGPKGRWSKANLTNVTDTKFTVSGLTQNESYEFRVMAKNAVGSVSNP
SEIVGPVTCVDTYGAPEVDLPQEYLDVVKYKAGATVQLKIGIVAKPQPTIEWYKDGKELE
SGAQISISNTTEFTCISVREATRLNTGTYELKIKNSLGSAYAAVRVLVQDKPGPPAGEIQ
FKKITADTMTIMWDPPADEGGAMVTHYIVEKRETSRIMWSIISEKLQDCIVTVPRLIKGN
EYIFRVRGVNKHGVGDPLESRPVIAQNSFVHPSQPSKPQVTMITRSTMTVVWERPSLDGG
SDIDGYYLEKREKKSLQWFKVIKDPIRDTRQKVHNLTEGNEYQYRVCAINKAGAGPYSDV
SIFYKAYDPIDPPSEPTKLRVVDSTKTSITLGWVKPVYDGGSEITSYVIEQRIADETEWV
TISSKGEVRTTEFVVSHLKPGVYYYYRVSAVNCVGTGRSIEIVQPVQAKDILEEADVDLD
ISMSTQYIAKAGRDVEIVIPLKGRPAPNVTWRKGDKNISGDARYAIRNTEYSTTLIIPKV
TRDDTGKYLLEIENGVGEPKTITVSVKVLDTPSACNRLIVKNVTRGKLTLSWEPPYIDGG
SPITNYVVEKKDAKMKAFTIVTNECANTTYKVDGLSEEISYFFRVSAENEYGVGDPCETE
QPVRATEMPGAIKDLVLVDSTNTSVSLAWTKPDHDGGSHINEYIIEKKTKDEETWSSGGT
CRRCQCEVTELKELSEVYFRVFAKNEKGRSDFSQIGPITVKEFLIPPEANLIDYPNGELS
VRIGQNVNIDLPYKGKPKPIIQWMKDDVILKESEQVRFRQTENKASLIVRNARKENAGKY
TLVLDNKLVKNFFDIKVITLGPPSQPIGPIRFDEIKAQSIIISWDVPQEDGGGEITCYSV
EKRETSQAAWKIVCSSVVRTTFKIPNLVKGTEYQFRVRAENKYGVSDPLTSPDVVAQHQY
KPPGPPGKPVVFNVTSDGMTVQWDAPGFDGGSPITGYHLEKKDRNSLLWMKVNTSVISGR
EYRVIGLIEGLEYSFRVYAQNNAGMSPVSEQSKHKLAISPVDPPGTPNCIDVTRDSVTLQ
WEPPKRDGGSRIVAYSVERRQGRARWLRCNFIDVSECQFTVTGLAAGDRFEFRVIARNAV
GTVSPPSQSSGYIMTKDESVIPQIEFEAEKSLTIKAGENIKLSCSISGRPVPQVTWYKDG
KEVDKMLVDITTVIGSSSLFIRDADRNHRGIYTVEAKNSSGTTKVDVLVRVQDTPGPPEG
PLRFTNISAEKATLWWSPPENDGCAAISNYVIEKRETSRISWALVTSKCEACSFNATKLI
KGNEYQFRVSAVNKFGVGKPLESDPIIAQMQYTVPDAPGTPDCTHVTGNSITLCWTRPRH
DGGNEIKQYILERREKKSLRWVKVSAKRPITELRHRVTNLTEGNEYEFRVMAENGAGIGP
ASGISRLFKCREPTSAPSAPTLVKVIDSTKTSVTLAWTKPVFDGGLEIIGYIIEMCKASL
EEWHRVNNQTCIQTHYRVTELESGEEYKFRVCAVNGAGKGEFSETPHIVQAVDRLTSPEI
DIDADFKQTHIVKNGGTVKLHIPFRGKPVPLATWTKADGDLGVMVDINTTDTFSTLTIEN
CTRYDAGKYTLSLENNSGRKTITLTVKVLDTPGPPGPLSFKDVTRGALTLMWDAPSNDGG
ARVHHYIVEKREASRLSWQEVSERCTRQILRVINLDIGVAYFFRVTAENQYGKGEPYEMT
EPIIATEEPASPKRLDVIDTTSTTASLVWMKPEHDGGSRITGYIVETRKKGSANWVFGGQ
TKSLKMVLEGLVENTEYEFRVKAQNDAGISQPRDALASVIIKEPRIEPTADLSSIDKQLI
TCKTGNSFAIDIPISGRPAPKVTWKLEEMKLKETDRVSIKISKDRTTLLVKDAKRGDSGK
YYLTLENAAGSKTFTVTVIVIGRPTPPTGPVEISGVSSESCVLTWGEPSDDGGTDITNYI
VEKRESGSTTWQVVNSSVKRTTIKVTHLTKYMEYTFRVSAENKFGVSKSIESQAIVAEHP
FISPSPPTRPDVVSVCANAISIRWDVPYHDGGSQVTGYWIEKKERNTILWVRENKIPCVE
CHYKVSTLIEGLEYQFRVYAMNIAGLSKASEPSRPVLALNPVDPPGTPEVYDVTKTSVSI
RWSVPFNDGGSKIVGYVVERKASSDDEEARWLKCNYTTITENFFTVTSLVEGEQYEFRVI
ARNGAGVHSMPSASSGLITCKDEYTPPKAELDSKLVGETISIRAGSDLVLDAAVGGKPEP
KVFWAKGDKELDPGEKYSLTYTSTRAMAIIKSCDRNDTGRYILTVKNASGIKTSAVNVKV
LDTPGPPAGTITISRVTDEKCTVSWKIPLEDGGDHVSHYIVERRETSRLNWVIMETECKT
LSCVSTKLIKNNEYIFRVRGVNKYGPGVPLESEPVIARNAYTVPTPPGTPDITAIGKEHV
IIEWFKPENDGGSEIKNYLVDKREKSSVRWTRVNKTYTIYDTRLKITGLLEGSDYQFRVS
AVNAAGTSAPSDASQYAHCKDPTYTPAPPSVPRITDTTKHSISMTWTRPMYDGGSDVTGY
IVEILEEGTEQWYRATQKTLTSTQYTVTGLASNKKYSFRVAAVNAMGTGEFSEGSMETAP
SERVEIPDIELPDELKKTVCIRAGNTLRLNVTVSGRPAPVITWRKTGIDLQSRGFIDTTE
NSTSLIVEKVHRYDAGKYTIEAENPSGKKTITILVKIYDTPGPCGAVNVKDYTKESVVIT
WDVPTIDGGAHINNYIIEKREASMKSYKTVTTECKKTLYRITGLEEGTQYFFRVLPENIY
GVGEPCETPEPVLVCEVPSVPQDLYLIDTTKSTVILGWEKPLHDGGSRLSGFVIEACKTG
TDRWMNVAHVKSSVLQHTIVSLTENEQYLFRIRAENSRGVSEPRDLMTPVTIQEQREMPK
IDLTGIPQKIVNVPAGKPIVLNIPIKGRPAPVCSWSFGGVKMKDKLDRIKIETTAKFTKL
TVRETTIDDTGDYTLNVKNVSGTATEVIRVIILDKPGVPVGPMKIEEVDATSVTCSWEPP
QKDGGANVSGYIVEQRDAHRPGWMSVSESVTRPVFKFTRLVEGTEYVFRVAATNRFGIGG
FLQSEVVECKSVKTVPGAPSTPEILDVSHDGMTLTWTPPEDNGGSTIAGYIIERKEAGSD
RWLSINKNPVTMTRYRATGLIEGLEYEYRVTAINSRGTGKPSANSKPTIAMDPIEPPGIP
LNPRVTDTTRTSVSLAWSPPEEEGGAAVTGYLIEMQKVDQVEWTKCNTTPTKICEYTLTH
MPQGAEYKFRVMACNAGGAGEPAEIPGVVKVTEMLEYPDYELEKIYQEGYVVRQGGVIRL
SVPIKGKPLPTCKWTKEGRDISHRAMIATSEERTELVIKEAHRDDTGTYDLVLENKCGRK
AVYIKVKVIGRPDPPEGPLEFDDIQARSVRVSWRPPSDDGGSDIFGYIVERREVPKAAWY
TVDSRVVDTSLVVKGLKENVEYHFKITAENQFGISKSLKSDESVTPKTPLCPPEPPSFPP
EIMDVTKTTIGLSWSRPKDDGGSRVTGYYVERREISTEKWVRHNKTHITTTMYTLTGLIP
DAEYQFRVVAQNDIGQSEPGPVSESVVCKDPFDKPGQPGEFDIISITKDSITIHWLRPES
DGGKEILGYWIEFRQAGESAWKKCNKERSKDRQFTIGGLMEATEYEFRVFAENETGLSRP
RRTAMGIKTKLSVGEAPCLKEDIKDTTTKLGESGILTCQIIGRPLPEIKWYRYGKELIQS
RKYKMSSDGRNHSLSVMTDEQEDEGLYTCRAVNEAGEIETSGKLLLQAAPQFHPGFPLKE
KYYAGCGTSLRLHVVYIGRPIPQIMWFYGKKPLNPSENVIIENTESYTHLVIRNVQRKTN
AGRYKVQLSNKFGTVDTVLRVEIQDKPLLPEGPVVVDALLKSSVIISWKPPKDDGGSMIT
NYIVEKREAKEGEQWHLVSSAVSGTTCRVPNLIESSGYYFRVSAQNQYGISESLEIPSVV
IIKSPFEKPGVPQRPFVSSVTKDSCVVSWKPPTSDGGAKIKNYFLEKREKKQNKWIAVTT
GEIHETSYTAKGLLEGFEYEFRVKCENIGGESDWSEISEPVIPKSDTALRAPFFKDELRD
MCVKYKANATFVTKVVGHPKPVVKWYKNGKEILADGAKIKVQEFKGGYFQLVISNADEND
AAAYQIRATNQLGSISTSMNLDVEVPAKIYLPLHLQGMGAVHAIRGEVVTIKIPISGKPD
PVVTWQKGQEIINNTAYHQVIITRSFTSLVFLKGVQRKDSGYYIICAKNRFGMDKQTVEL
DVADVPDPPKDVKVSDIGRDTLTLTWSPGNDGGSEIINYIIEKCPTTGDRWIRVAQTSES
QYTVMSLFGKTKYQFRVIAENRFGVSDPSAPTDPVTTKEDKLAIRNYDEEVDETREVTKE
EAPHSKVKHVPSLYTVSEELARNGQFGIVHRSIEISSKKTFLAKFIKVKGADRELVAREI
ETLNIARHKNFLYLHESFDSLEEYVLIYEFLSGMDIFERLGINFDLTEQEIVQYLRQVCG
ALKFLHSKNYCHFDIRPDNIIYSTRKSNTIKIIEMGQARLLTPGENIRIQFTAPEYYAPE
IHTSDFVTTATDMWSVGVLAYVLLSGLNPFASESNQKMIEHISNAEYMFDSEAFKETSLE
AMDFVDRLLTKDSKLRMTASEALEHPWLRMKLEHVSSKVIKTLRHKRYYQSLVKKEWSTV
VSSARVAYGGGYRNQKNVSIGRVKIGHPQQGLRAGPIMHGSAEEGGHVRFVCCIENYDRN
TEVTWYFGSRKLTASHKYEITYANGVASIYVKDIEECDDGLYRCKVVSEDREDNAYAELF
VETVRSFREYYLGRSLKKPRRRIDKSKILQRPPEFTLPLFNRSAYIGEDVRFGVTITVHP
EPSVTWLKAGHRIKPDPKKYTFTSDKGLYQLMIHNVDLSDDAEYTVVANNKFGEDSCKAR
LNVAPHAVAEDTMRPMFKRLLANIDCVEGQSVRFDLRVSGTPAPTLKWEKNGKPLEFRPQ
VEVVQEDVDYFILHIRETLIEDSGTYRVTATNTAGSASCQATLKVERLTYTRREFKSEEE
RHIYVRNQIEKTLKMAQEFSKAEVVALNPVAQEALKEAAELYKPAVSTKHVQGEFDISDK
EDQEIKKIIEEEKKIRMPYEIPEARAHDPTVLDEDKMIKHFVPLSDMKWYKKLRDQYEIP
ERMERIVQKRQRRIRLSRWEQFYVMPLPRITDQYRPKWRIPKLTQDDLETVRPARRSPSP
ESEASFRLRRRSLGDISDEELLKEEEYLATKLSEKERRELEEELELGFSASPPSGSPVRF
ELSALRRASPRPVHRAEVRRVEETKHVTTEQARGSPPPISHFLRRRRSLSPTYIELMRPV
SELIRQPRARIPTEAEVEIIERRSPTPERTRPRSPSPVSPERRSSRSSSRFERSARFDIM
SRYEARKAALKSERKYQVVTQQPFSLDHAPRITVRMRSHRVPCGQNTKFTLNVQSKPDAN
IQWFHNGQQIQESHKYQFTNMSGVLSLQINDCQAEDTGTYRALCTNSKGEASDYATLDVS
GGAFTTYSSRRRDEEAPTQIVPDITKTDYYHSTTIRASSASRTHLEIQEFKTKLTERHEV
SSFEKYESQRLASSPIRYASTEYLSSASYSSSERHTTSEKHVSSESKLKESETSAEVSVK
KIKATLSAKILTKPHSLIVSEGDSARFVCDIDGEPAPTVTWMHEGRTVVSSHRIHVSTTQ
YKSTLEISSVEYSDEGNYTVVVENSEGKQEARCTLAINKPILKEEVTPTQVKSPEPSVAS
PVPPIKSPESSVTSPVPSVKSPEPSVKSPVPSVKSPEPLVKSPVPSLKSPEPSVKSPVPS
VKSPEPQIKSPEPTGIKSPEPRIKSPEGIKSPFRVKSPEPATSLQRVKSPPPLKSPEPTT
PQGVKSPIASPPRVKSPPPIKSPEPIASPLRVKSPTGLKSPEPQRAKSPPTVKSPEPIMS
PKRMKSPLTVKSPTPSKEAPPKIIQQLKAEAFEDKIRMIFVAESSLREVVWYKDSRKLSQ
SSHYQIHSSADGTCCLYISDVSEDDQGEYSCEIISEGGAVSRTSFSFVGQVFQAIYTKVT
AFVAAHKAVQESVSSKIQGGSEMVIKRESAAVSSMHESFTSKSIHMESTMQEASFSSSAM
AEMKFETMSMSSMSSMTSESVYAMSSSSIMSSHSHAEETSVRAALHSAQGLAPRIEALPE
DISVETGKVLTVACAFSGEPAPHIEWSRGGKKLPGEEDSSRFHIETTEDLTTLIITGVKE
TDAGAYTLKLSNEHGSDLATVTISIRSK
NT seq 94407 nt   +upstreamnt  +downstreamnt
atgacaacacaggcaccaacatttacacagccgcttcagagcgttgtggcacttgagggt
agtgctgcaacgttcgaagctcaagttagtggtaatccagttccagaggtgagctggttt
cgtgatggccaggttcttactgctgccgctctgcccggcgctcagatctcgttcagcgat
ggccgcgctgttctgatgatccccgccgtgacagccgcacacagtggaagattttctgtc
agagccaccaatggtgctggacaagccactagcactgctgaactgctggttacagccgaa
actgcaccaccaaattttattcagagactacaaagtttgactgtgagacaagggagccaa
gtgagactggatgttcgagttacaggaatccctgcacctgtggtgaagttctacagagag
ggagccgagattcagagctccgctgactttcagattgttcaagatggagacctttacagt
ttgttgattgccgaggccttcccagaggattctggaacctattctgtcagtgcttctaac
agcagcggacgtgcaacttcaactgctgagttgcttgttcagggtgaggaagaagccgta
cctgcaaaaaagtctaaaactataatttcagcctctcagatatcacaaactcgtcagact
cgggtggagaagagagtggaagctcgttttgaggccactgccacaatgcaaatgcaggtt
gaaagtggagttgttacagaacatctggcacataagactccacctcgtgtgcctcctaag
ccaacctcaaaatctccaccttcacaactgactaaagtttcaactgctcgccaacagtct
ccctctcctgtgaggcatgttaagggcccgacacccactcctgtcagagctgtgtctcca
tctacaagattgtctgtttccccaatcagacctgtcaagtcccctgtgatgacccgcaaa
caggtcacgccgtcctctgaggtcttgcccccatggaagcaggcagggtatgtttcagag
gccagctacacccaaatgattgctggaacaacacaagtccagacctccacccaggtccaa
atggagcagcgttgggagggatcggttgcaggtgtcaaagagggtgatgggaaaaaagca
gaggctgtggccactgtgcttgctgctgttgatcatgcacgtatacgaaagcccatgcat
gttgaagggcctcagatggaagaagagactgatgtaagacatcaagaaatgcttgcaact
aagcaacaggtcacaagtaaaaaggagctgttgctaattccccctgaaatgacaactact
tctactgagaagactgtgcatgtcacccagattcaaagagctactgaggtaagctccaag
gtggagactgaccttgcaccatcaccagttccacatttcacagtatcaaaagttactgta
ccaaaaccagaccatagctatgaggtttcaagggcaggttctgctattgccacacttcaa
aaagagttatccacaacaactgcttctcaaaagatcatcaagcctgtaaagcctccatca
cataagattgtggagactcatgtgaccccagagccgaccccatctccttttagagacact
acagagagatatcagactcattttgacacagagttgcacagaaagataggcatttcatat
gctggtgaagagtgggacacaaaggttcctgagactgcagcaatcccttcagctgtcaaa
gagcctgttgtgccccctacactgatagcaggtttgaagaatgtgactgtcacagaggga
gagtctgtcactctggaatgccagatttcaggtcaccccactccagcaattatgtggttc
agagaagattacagaatcgagaactccattgacttccagatcacttatgaaaaaagttat
gcacgcttgatgattcgtgaggcctttgctgaagatagtggccgcttcacttgcactgct
accagtgaggctggaactatcagcacctcctgctacctgctcgttaaagtatctgaagag
attgagagcagagaggagattactgtccaggagaaacagactgtcgttgaagccaaagac
gagaccatgtctgaaataagttcagtctccgtggacactggagcacctgctgctcctttc
tttgtgaagaagccagtggttcagaagttggttgagggagggagtgttgtctttgtgtgc
cagataggtggaagccctaagcctcatatttattggaagaagagtggagttccactcact
actggatacagatatagagttagccacaacaaggacactggtgaatgcaagctggaaatt
tctatgacatttgctgatgatgctggagaatacacaatctttgccaaaaaccaacacgga
gagacatctgcttccacaagtctccttgaagaagaggagtttgaagcctatatgaagaaa
caggatgtgacatatgtaacagaggtgacagcaatggtgcaagagcccaaagtggcagat
gtgcctcctgtagttgtaagtgaatatgaaaaagagctcatacagaggaggatggctcag
caaacacaaatgatgcagaccttcatctcagagacggagtttcaaatatctgcaattgaa
aggaaaattatccaagaaattgaaatccgcatccttaaaattacttaccaagagctggtg
attgaggacggagaggagatggtcataaatgttgctgagcatgaggccgttgcatcttca
tttagcactcctgtgaaaagctacagaattcttgaaggaatgggtgttactttccattgc
aaaatgggaggaaaaccattaccaaagattgcctggtacaaagacggcaagcgtataaag
catggaggacgctaccagatggaggttttacaagatggtagagccagtctgcgtctgcct
gtggtgctgccagaagatgagggcatctatactgcatttgccagtaatatgaagggtaat
gctgtcagttctggaaaactctatgtggagtccactgctgctgctcagccttactatcct
caggctgaagctgtgaggagagtccagtccacatctccaatgtctgctcgctcagccagc
tactcccctggacgttctcctgctcgctctgttagccgatctcctgcacgtagacttgat
gacacggacgagagtcaactggaaaggctttataagcctgtttttgtacaaaagccctct
tccttcaggtgttctgaaggacagacagcaaggtttgacttaaaagtagttggaagacct
atgcccgacactttctggttccacagtggacaacaagtggtaaatgactacactcacaag
attgtggtgaaagaggatggaactcagtcaatgattgtcgttcctgccatgcctcaggac
tctggagagtggacagttgttgctcagaacagagctggaaagacaactgtttctatgact
ctcactgttgaagcaaaagagaatttagttcgacctcagttcattgaaaaactgaagaat
atcagtgttaaagaaggaagtctggttgagttggcagtaaaagccattggaaaccccctg
cctgacattgtctggctaaaaaacagtgacatcatctctcctcataaatatcctcacatc
aaaattgagggcgccaagggacaggcacattttcagattcctcaaacttctggctctgat
agtgcatggtacacagccacagctataaacaaagctggcagagatactactcgctgtaga
gtcaatgtggaggtagaatacactgaacctgtaccagagagaagacttatcatccccaaa
gggacatataaggctaaggatgttgcaccaccagagattgaaccactgcatcttcgctat
ggtcaggagcagtgggaagagggtgacctctatgacaaagaaaagcaacagaagccacac
tttaaaaagaaacttacttcagtccggatgaagcggtttggacctgtgcactttgaatgc
agacttacccctattggtgaccctacaatggttgttgaatggctccatgatggcaaacca
ctcgaagctgctaacagacttcggatgatcaatgagtttggctattgcagtcttgattat
gaagttgcttattccagagatagtggtgtcattacttgcagagctacaaacaagtttggt
gccgaccaaacctctgccacactaattgtgaaggatgagaagagtctggtagaggacagt
caattaccagaaggaagaaaggtacaaagaatggatgaaatggagagaattgcccatgag
ggtggaccctctggagtaactggggatgacatgtctgagaagtccaagccagagattgtc
ttactccctgaaccaataagagtatttgaaggcgagacagccaaatatcgatgcagagtg
actggttaccccactcccaaagttaattggtaccttaatggtctgctcattcgaaagagc
aaacgattcagactacactatgatggcattcactatttggaaattactgactgtaagtcc
tatgattctggagatgtcagagtattggctgagaacccagagggtacagctgagcatact
gtcaagctggaaattcaacaaaaggaagatttcaggacaatcttgcgccgtgctcctgag
ctgaaggctccagaggcacctggccctgaaccgggcagagtatcctttgatgttgtaaag
gtagataaacccacagatgcttctcaagcaaaagaagttgtccgactgaggaaagctgag
agagtggttcatgaaaggtctacagaagaaacagaagagctgcgaagcaaatttaagcgc
aggactgaagagggctattatgaagccatatcttctgttgaattgaagtctcgcaggaaa
gatgagtcttatgaaggaatgctaaaaaagagaaaggaagaacttctgcactggaccaaa
gaggtctctgaggcagaaaagaagaaagaggaagaggaacgcaaacttaccattcctaca
atcagacccgagaaagttgcactctctcctagcatggaggctccgaagatcttggaaaga
attcagagccagacagttgctcttgctgatgaagtacgctttcgatgtagggtaattggt
aaaccagatccagagtgccagtggtttaaaaatggcattttacttgagaagtcagatcgg
gtttattggtattggcctgaagatcatgtctgtgaattagtaatcagagatgtcttagct
gaagactctgccagtatcatggtcaaagccattaacattgccggtgaggcctcaagccat
gccttcttgttggtgcaagccaagcaagttgtatcttttacccaaacactggaggatgcc
tatgctaaagagaaagacacaatggtaacctttgaatgtgagacaaatgagccatttgtc
aaggttaaatggatgaagaacaatgctgaaatcttttctggagacaaatacaggatgcac
tcagacagaaaagttcactttctgtctgtgctgataatcaacatgcaagatgatgcagag
tacagctgtgctgtagttgatgatgaccacataagaaccactgccagactttatgttgaa
ggtgcaccactggaaattgttaaaaatcttgagagcgttgaagtacccgagacatattct
ggagagtttgagtgtgaactttcccgggaagatgctgaaggcacctggtattttgagaat
aaagaaatcactccaagtctaaaatatgttgtatcctctcgtcgtggcagacacaccctg
tctgtaaaagatgtcaggaaggaagaccaaggaaagtacacttttaaagtgggagacctg
aagacaagtgccacactaaagatgaaattacgccccgtaactctgatgcaaggactctct
gatctgacaatttgtgagggtgatattgcccagttggaggtgcgattctctcaggaaaat
gtggaaggaacatggatgaaaaatggcctaccaatctctgcctcagacagagttcacatt
gtcattgataaacttgtccacaaacttctagttgaaaatgtcaataaggatgatgctgga
atctactcatttgttgttcctattcaagacatttctacgtctggaaaactgactgtgcaa
tcaattgaaataatttctcatctaaaggacgttcattctatcgagggtacaaaggcagtg
ctagaagctaaaatctctgcctctgatgttgctgctgttaaatggtaccaaaatgacaag
cttcttgtggctagtgagagaatccagatggttgctaaagggaccaaacagagactggtc
ctgaacaggtcctttggttctgatgaaggacagtataagatggctgtgggcagagttgaa
accacttgtaacctgacagttgagaaggtcagcatcatcaagcacatggaggactgtgtg
tgcacagaaactcagaatgtcacatttgaagttgaattatcacacactggtatagacgct
tattggaccttcaagaatcagcctctcaaggctggccccaaatacaaaattgagtccaaa
ggaaagcactacagtctgaccatcatcaatgccatgaaggatgaagagggcttgtatgca
tttgcagcaggagaaaagatttccagtgcaaaactaactgtgtcaggtggtgctataaac
agaccactccatgatgtgactgtagcagaatcccaaactgctgttatggagtgtgaggtt
gctaatcctacatctgaaggcaagtggcttaaggatggccactctgttgacttcagtgat
attgtcaggagtgaggatatagatgctgtccgtcgacttatttttgttatcacaagacct
caggatattggagagtacacataccaagtggcaaattccaagacatctgccaacctaaga
gttgaagctgtgaagatcaagaagacactcaagaaccaaacagtcacagaaactcaagag
gcagtgtttagtcttgaactcactcatttagatgtgaaaggatcccagtggatcaagaat
ggagtagaaattgaacctagtgacaaatatgagattacagtagatggattagttcacact
ttaaagatcaagaactgcaactctcaagatgaatcagtttatggattcaaactgggaaaa
ctgtctgctaatgccagactgaatgtcgaaaccatcaagattgtgaaaaagccaaaagat
gtgacttccctggtaaatggaaccgcctcttttgagctgagcttatctcatgatgacata
ccagttaaatggatgttcaaaaaccaagagctgaaacctagtgctaatgttcagataatg
tctgaaaggaaagcacataagttggttattcagaatgttgaagaaagcaatgatggagaa
tacacagccgttgttggacatttacaatgcagtgcatatttgcatgttgaatctttgaga
gtcacaaaacccctaaagaaccttgaggttccagagacccatgtggccacatttgagtgt
gaagtttcacacttcaatgttccgtccacctggctgaaaaatggagttgagatcgagatg
agtgagaagttcagaattgtggtgcagggcaaacttcatcagctgaagatcatgaatacc
agcagagatgattctgcagaatacacctttgtgtgtggaaatgacaaagtctcagccacc
ttgacagtcagccctgtgctgattacatctatgctcaaagacctgaatgcacaagaaaag
gacaccatcacatttgaggtgaccgtcaactatgaaggcatcacttacaaatggctgaag
aatggagtagaaataagatccagtgatagatgtcaaactcgcactaaacagctctctcac
tccctcaccattcggaatgttcactttggggatgttggagactacaaatttgtggctgga
tctgctgaaacagcagcaaaattgtttgttgaagctcgagtcattgagttcaccaagcac
atcaaggacattaaagtcactgagaagaaaaaggctgtttttgaatgcgaactctctgag
cctaatgtccaagtaacatggatgaaagatggtcaggagcttgaattatctgagaggtac
aaggtctccacagagagacacgtgcatcgtctcatgatccaaactgtgcgcatgtctgat
gctggtgaatactctgtggttgctggatccagtgtatcaaaggccaacctcacagttgag
ggcaaggatgtgcgcatcagtgagcctgcagagaaagaaattactgttcttgagaaacag
agaagtacatttgaattcgaagtcaatgaggatgacattgaaggtcgttggctaagaaat
ggagtggagatccagttttctgttgatcagcgctttaactatgccattattagaaaaatc
catcgcttgacaatcacagaaacgtacagaagtgatgcaggagaatacacattcattgct
ggaaagaaccggagtattgtgaccctgcatgtgaacatccctgagcctcctcagatcatc
aggcacatgcagcccctgtctgttgaagctggcaaacctgcacgcttctctgtggaggtg
actggaattcctcagcctcaagtgtcttggtataagaactcccaggccctgtcctctgga
ttcaagtgcaagttcctgagggagggaaatgagcatacattgctgctcatcgaagtcttc
ccagaagatgcagctcagtataactgtgaagctaagaatgactatggagttgccacaagc
tcagcttcactaaatgttgaagttccagaagttgtttcccctgacactggagcaccactg
tcacctcccgtggtcttaacaccaatacaaaatacttctgccaatgaaggacaatctgct
agattccagtgcagagtctcaggagaagatctgacaataacatggtattgcaaagacaag
gaaatcaagcagtcagacatatttagagtgtctcagtttgatgaaaactgtcagctggag
atcaccagagtttatcctgaggatgagggcgagtacacatgtgtggcccgtaactcggct
ggaatggtctcatgttctgctctactgaaagttgacgttacaagagtacgagaggagatt
gaagcaaaaattgaggaagaggtcaaagaattttctagtttgactgtgaagaccgaagaa
gaggaagaaacctacagcacatcactgcatttgcctgaaaaatcaaaaacacttgaactt
aagccagagcaaaaacgtttttctagttctttggaaagaaaaagagagaaaccagtattt
gagtcaaagcttacacctgctgaagttactattggagagtcggttaggtttactgtcaca
gtatctggttttccaaagccaaaggttcagtggtttcacaatggaaaggctatcacttca
tcatcaatttatacgtttgtagaggagagagatgaatactctttaataataacaaaagtc
aagaaagattatgaaggagagtattcttgtactgcaagtaatagatttggccagactacc
tgcaagacaatattaaaggtagaactgagtcagttatcagcagcagaaaagtgggtggaa
aaaatgttcaaaataccaggacaacctccatgctttactacacaaatccaacctgttcag
tgtgtggaaggtagcgaggtaaaatttctgtataaagttactggtacaccatttcctgat
gttcagtggtttaagggcaattctcaaattaagtcaagccagacctgttctgttgtgtgc
aatccagatggctctggcttccttattatgagtaatattcaacagagagacagtggactc
tacacatgcaaggctgtcaatccttttggggaggcaagctgcagtgctgagttgattgta
ttccacaaacaagtctctgtgtttcataaacaacaattagttcaagaacaaaaaagttac
aaggtgtcgatgaaagaggaagccaccgaatctcgtttgtatagtgttagcctgcctgga
caggcaggcgctagtttgcagggagaccatcaggtaatttacaccattggtactgaagac
aggcaaatggttgagagtgagcaggttgatacactgcacgacttggatgtttccattgca
accgtgcacaaagagcaggtgactcatcaagctgctttgctgcagtctcatgaagtgcag
gagagagtaatatcagctcaagttcgcccagaaccagtggtagcaactcctttgagacag
ctccaaatggccactatgacctccgcagttcaagaaagccaaggcttcacagaacagcac
tttgaacgaatcaaaagtcctgaggttacagagatacaaattgccaaagagcacccatcg
caagtaatgtctgccttaactgagagtgtaactccattaacgattgtcaaagcagagcca
ttatccactttagaaacagaaaagattaaggcatctcctgagcccaagtatccaatatca
agtcaccaagttgagacaaagctcccaattgttaaagaacattcagaggttataccccat
actcagcaagaaaagggttatcaagttaaagagggagttaaaattctttacagtgcagtt
tcatcagagaaacaacagtttacagagggtcactctaaagaactatcaacagaagaacca
acttttcagacatcggtgaaaaaagaacaacacaaaccggttgtactttcagttaatgag
acaactcagaccttatctaaggaagagagcttatcagtgcagaaaccaggtgttgagact
gcatctcaagtgaaagacagtgtctttaaatcagctcttgttgctgaggaaaagcatcag
ctccaagctgatcagtcaagtttgattccaggtttagacagtgcaatttcagtgcaaccc
ctaagagaagaagaacaagttcaacatttgcaagttatcacagatcaaggtattcttcca
gctgaaggaaggtttagcagtgagaacccaagcccagagaaagcagatgctcaaaaaagt
cctctacttaagcatacagtgtcagtggatttacagcagacagtgacatgtgaggagtcc
tcagagttttcaggacaagtaacagagctttctattcagcctggtaaggcagcgcctgcc
cctttgcatcttcaggcagttcattcagaaaatttgttgacgaaagaagggataatctca
atggaaaagccagatgaacagactgcagtacagaagcaagaaaaagctcggcatcatgct
gctagcactgaggagaaaatagagcatactgcagattattgcaaagatctcgctgtgtct
gttacaggtgtgcagtctgaaatcagaaaagagcccaaacctgaaagtattcttcaagtc
atttcaacaccagtgcccttgccgaaggaaagtccttttgtaagcgatgttaaacagcag
cgtgccctagttcagaaagaagaccactggaatattgtacatgtgccatctgtgtctgag
agtcaggatatagaagagggacactcagagaccatagagtcaattgagaaatttgtatct
aatatcaaagttgaaccaaaaataccatctgaattaatttatgtagaagaaaaggctatc
tcaacagagagtagcattgcccttgaggccaccgaacaagactttgcacttcaaattcag
gaaggtcagtctgttaggcagtcagtgttaatggaggaaaaacgtgttattaaaggtgag
ctttctcaggatattacaaagtctgaaacaaccacagcagttgtcagtgagcagaaaatg
ggtacgcttttagtgtcagagtcaagagagagccagagtttacccaaggagctcactttt
gtcgtttctccccctaaatcacattcactagacattaagcaccagttaaaaagtacactt
gcaactgcagtcgctcttgaccagccattgatcctggccgattttgtggagagtttggga
gttgtagaaattcatgaggtaaaagtaaggaaagaacccaaatatctcatgttcacttat
cttattacaagtgcaagtgctccacttgaaattacaattgcatttgaaggcgagtatcct
cagactgctgatctcagaagtgaacttcaagctgctttttactctattgtctatcgagag
cagaacgttctgacctcagagcagccaggcacattacaaattgatagaccccaaagacta
caggtcacaaaggcttctacaaaagaaatgctttcacctgtggtggaaatggttaggctc
tcagaaaatgtggagcctttcacatctccaacgtctcagtcagcaactgtgaaaactgaa
gccaaaacatcttttcaatctgtgactgctaaagagcaagcttttgtgcaagagtcaatt
catatagcaagtgaatcaaaaattgagattcaacagtccattcaagttgagcaacaggaa
accagatctgtgacagtaaaaagtgctacaagtatgacaagtgagcttgttttaggacct
cttccaattgaacggtccactgaaattgcctttcagaaagaggaaaaggaggaatacata
actgaagcattaatggaattagagaaagaagataaagagggatacccagtttttgaaaac
tctttggaggatattaaaacagaggagcattcagaagctaagttttcattgattatccga
tacgtaaagaaagtaaattggctctttaatggaaaatgtattaaatctggcaaagagttc
aagtgttctaaagaacatgacacttacacactagtaatcaccaaggtaatgaaggatcat
gaaggagaatatacctgtgaggctgtaggtgaagctggcaagacctctacatcgtcccac
ctcactgtgatcccaagagtgccacccgtttttaggcagagaattcagaatctggaggtg
aatgttggcagttctgcaaagttcgaatgtgagattgaggaggctcctggtgtgaccttc
aagtggttcaaatcgggtactgagctcaggcacagtgaaaaatgcagaattataagccga
caccacacatcatcgctggagatctttagcccagcagtcgctgacagtggagaatatacc
tgcaaagcttctaaccgccatggaagtgatagctgctctgctaaactaactgtgacagag
cttttcccaccagaatttgtatcaaagcctgattcgatgactttatttgttggcaagcag
gcaaaatttcaatgtgttatttctggttctgagccaatgaatgttgtctggcataaagac
aatattgccatttcacttgatgaccactacaaagagtcttctgacaagaaccggtatttt
cttgaaattttgaatctacagcacagtgatcaaggcacatacctttgcaaagcttccaat
agtgttggtacagcaacatgctgcactgaactgagggttgtagataaacccagctttgtg
aagagctttgagtctaccactgttgctgtgggaaacccactacgtcttgagtgtcaggta
gatgaggacactggtgtttccatcatttggatgagagatggcaagaaactccatactaca
atggattgtaaactagcatttgaggagaaaatagcctgtcttgatattcagaagtccaaa
ctcaaagatacaggcacatatacctgcactgctgccaatgaagcaggaagcagcagttgc
tcttctagtgtgacagtacaagaacctccagtctttgttaaaagactagagcctaagatc
ttatggaagcaaggaatgtcatcgcgtctgtcatgcactgtcaagggatcaccagaactc
cacgtgacctggtttttaaatgacaagccactaaactcttcagaaaaacacaagatcacc
ttcaaaaccaatcaagccactcttgaaattattgacttgtctgagtctgacagtggaaat
tacacttgtgaagtgatgaatgaggctggctgtgaaagctgcagctctcaagtgacagta
aaagaaccacctgcctttaaaaaggagctgcggttggtggaagtagtcaaagggtgcaca
gcccatcttgaatgtgaaatgacaggcactgctccttttgaaataacctggtttaaagat
aaaaacccagtatcatctgacacaaagtacaatattgtctcaaaggagacagcagcctat
ttggaaatcaaaacatttgaaagtgcagatgttggagattaccagtgctgcatttccaat
gatgttggtaaaataactacaaaagcggtggccaaactgaaagacccaccatcctttgta
aagaaagttgagaacactactgcggttttaggcagtgctgtaaaactgcaagggactatt
aagggttctgctcctatcacagttcagtggtttaaagatacagagatagtcagagatgat
gatcctaatatcaccacaacctttgaaaacatcattgctgttttagctatttccaatgtg
gccattaaccatggtgggaaatatacttgtcaagctgaaaatgaggctggaaaacaaaaa
tgtgaggccactgtaacagttcaagaaccagctagatttgttgagaaacccccatgcatc
agtgtgactgcaggtgactctgcaactcttgagtgcaaggtttcaggaagtccagatctc
aaagttaaatggtttaaagatggcaaagagatggcagggggtcgaaagtacaaaatcact
ttcaaagagaatgtggccgtcttgaaaatcctctcggcagagagaggagatagcagtgaa
tacaaagttgaagtatccaatcgagttggaaaagagcagtgttcttgctcaatcaatgtt
cttgataaaataatacctccaactttcacaaaaatgcttaaaaaggtagacggtaatgtt
ggagctagtattcaaatggagtgcaaagtgtcaggatcccagcccataacaatatcttgg
ttcaaagagggaaaggacattacaactggaacaaaatatcaaactgaaatgcaggaaagc
actgccttactcaaaataacaaatttagagacatcagatgctggggttttcacatgccat
gcaactaatgctgcaggacacagtgaaacaagtggaactatttctgttaaagaaccccca
gtcttctctttgaaacctcaaagccaagatgttatacctggaactacagttgttctaaca
gctgcattcactggaacagcacctttcatgattaagtggttcagagaagacaaagaaatg
ttaactggaggaacttgtttcatcaaaaaagaaaccaactcaagttcactggagctgcac
gctctgaagccatctcagtctgcaaaatacacttgccaagtttctaatgatgctggaaag
gtctcatgcacagctgccttgtttgtgaaagaacctccaaaatttgtgatgaaacttgat
ttgactaaacttgtattgaatggaagtcttgcaactttggaatgtaaagtggctggcagc
ccagagatcagtattagatggtataagaatgagactgaaattggctcagatgataaatac
caaatggccttcaccgactcagttgctacactaaggatttccagttgctgcattgaagac
agtggagattatatatgccaagcatcaagtgatgctggcagtgatagatgcagttgcttg
gttacagtcaaagaacctcccgaatttgtgaaaccttttgaatccaaagaaattgttaaa
ggcacagatgttgtgctagaaggaactgtgtcaggctcagctccttttgagatttcctgt
ttcaaagactcaaagcagatccgaaatgatagaaggcacatcataagcctgacaaaagat
gttgcagctcttcagattctgaaatttgaaccaggagatgctggaaaatatcaatgcact
gtagggaatgaagtagggcagacctcctgtgactttcttgttaccatgaaagagccacca
tcatttgtgcagaagatggataatacaaatgtccttcttgccaaggatgtgtctttgcag
tgtgtattgaaggggtcaatgccaatgaccatctcttggatgaaagatgaccatgagatc
aaagaatctgagcatgttcagatatcttttgagaatcagactgcagtgatatatatttct
agtgtgcagttaaaacatggtggaaagtatacctgccatgctcagaatgaagctggtagt
cagaaatgtacagcagtactgacagtaaaagagcctgcaaacatcacagagcaagccaag
tctgtcagtgtaacagtacgtgatcctgccactctagagtgcaggtattctggtactaaa
gttcttaaagcaaaatggctcaaagatggcaatgagctgacatcaggcagaaaatacaaa
atacagagttctgatacaagctccatattaaaaattctttcggctgagaagagtgatgct
ggagaatatacctttgaggtttcgaatgatgctggaaggagcagttgtgaggccgttgta
actgtgttagaacctccatcaatcattgagaagccagaatcacaagatgttatacctgga
tccaaagttcagtttaacgtgcttttgtctggaacaccaccgctgaccattaattggttt
aaagataagaaagaagtttcatcaggaattgactgttcagttcagaaaaatgacacgtcc
agctctatagagctcttttttgctaagccttcggactcaggacagtatgtctgtgaagtt
agtaatgacgttggatcagattcttgccaagcaactctcttcgtgaaagaacctcctaag
tttacccgcaagcctgaaaaaataacagtggtgaaaccaagccaactggtagtttttgaa
tgccagattacaggcactccggagatagacacgtactggttcaaagatgggaatgatata
agcccaagtgacaagtataaaatgacctttgtcgattctcttgcacggcttgaaataatt
agcagtgatatcaaagacagtggtgtgtactactgtgaagctcgcaatgaggcaggcagt
gagagttgtagtatggatctaagagtcaaagagcccccagttcttgtcaagccattgagt
cctcttgaggttgtgaatggctcaaatgcatattttgaatgtctggtaaaaggcacagct
ccttttgaagtgacctggcaaaaagattcaaaggacatcaaatcgagccttaagcatgtg
attttgcagaaaaatgactccataattactctggatgtacagaagtgtgatgctttagat
gttggagaatatcagtgcgttgttgcaaatgaagttggaagttgttcgagtcagagtaca
ctcagcataaaagagcccccatcatttgtggagagaattgagaatgttgtcacagttctt
ggaaaaatggttgagtttaaatgtgttgtaagaggatctccacccctgtccatacaatgg
cagaaagatgagagctggatcttggaggatccttcaattcagaggacttttgagaacaat
gttgctactttgacaatccctgtgtgtgagtccatccacagtggaaaatacacgtgtcag
gctatgaatgaagcagggcaagagaagtgtttttctaccctggtagtgcaagagccgcct
cagataattgaaaagcctgaggtgattaatgtcactgccggagatccagtaagttttgag
tgcaaagtgtcaggcactcctgagctgaaagtaaaatggagtaaagatggcaaggaagtg
atcccttcaagacagcacagcctcagctatatcaataatgtcagccaacttaaacttcag
tcggtccaactggaagataaagggacttatgtgtttgaggtctccaatcacatcagtgcc
tgccagtgtaaagtgacactaaatgtgctagagcaaataatccccccatccttcattaaa
cctttgatggagatggaagaaataattggtaaaaatgtgcaaattggatgtaaaatatca
ggttcgctccccataactgtggagtgggaaaaagatggaactaaactttcagggagaacc
aaacacaaaattcttcaggatgagaacagcatgtctttggatatcgagtgtttagaaaaa
gctgacactggaacttatacttgcaaacttgcaaacaaagcaggaagttgtgaatgcagt
ggtacactgagggtgaaagagccaccaagctttgtgctggttccagaatcacaggctgtc
ataccaaataccactgttcgctttaagggttcttttaagggaactcctccattcacagtg
aaatggttcaaagatgatactgagttgatttgtggaccttcctgttttactggcctggag
ggcctctcatgcttcctagatctttttgccgttggaatatcacacagtggaacttactct
tgtcagataagcaatgatgctggtactgcaaaatgcaccacaaccttgttggtaaaagaa
cctccagagtttgtacagaaactgccagctgcaaaagtcgtaaaaatgggggagccgctg
cagcttgaatgcaaagttactgggacagctcctctgagaataagctggtacaaaaacgat
gccatactcagtgatggtggcaacttgagaatgactttcgataactctgtggcagtcctc
gaaatttccacatcaagctttgatgataatggtgtctatacatgtgaagcacagaatgat
gctgggactaagagttgtagtacagctctcacaatcaaagaaccaccaagtttctacaaa
ctgccaacaccagttgaggggctgaaaggcaaagatgccagtcttaactgtgagctgaaa
ggctctgcaccatttgagataacatggtttaaagataaaaaacagttaaaggagagcagg
aagtataaatttgtttctgagggatgttcagcaactctccacattctcggactggaagca
tcagatgctggagaatatgagtgcaaagcaacaaataatgttggaagtgatttgtgccaa
ggctctgtaaagctacgagaaccacctgcatttgtgaagaaattatccaatacgacagcc
atctctggtgaggaggtagttttgctgacaacagtcaaaggctctcagcctatgactgta
tcttgggttcaggataaagaccacatactcagagatggtgaaaacagaaaaattacattt
gagaataatgaggtcaccttgaaggtctttaaagctgattctactactgctggaaagtat
acatgtcagctaaaaaatgatgctggagtagctgaatgcacagcgaacctaactgtctta
gaacctgcagcaattgtggataagacagattcaatcagtgtaactgctggtgaagccgca
gccttagaatgcactgtatctggaactccagaacttaaaccaaaatggtttaaggatggt
gtggagctgtcttcagggaaaaaatacaaaattaccttttcaaagatgatttccagtctt
aagttattgtcaacagagaggagtgatactggagaatacactttcagtatcaagaatgaa
gttggcagtgacagctgtgcaatgcagctaactgttttggacaaaattgtcccgcctttg
ttctcacgaaaattgaaagatacgcagagtattgttggaaaatctatggaattggactgt
aaagcttcggggtctgcacctctcacaatctcttggtttcacaatgaagtggagatcatg
agtggaccaaattatgagattactttcactgaaaatacctgcaccctgaaagtgcctact
ctgaagctttcagactcgggtacatacaaatgtaaagcagtgaacagtgcaggagcagca
gagacatctgcttccttagttgttaaagaaccaccctcttttgtgacaacacctcaacca
gtggaagcccttccaggcacaactgttacttttacagcaactgttcaaggaagtacccca
atgaaactgaaatggtttagaggcagtaaggaaatagtgtctggaagaagctgtgagatt
gcgttaagaggagatactgcaattctggagctccacaacattgacaaatctcatgctggc
gagtacacttgccagatcattaatgatgcagggaaagaaaactgccctgtgaatcttttt
gttaaagaggctgcacactttgtcaagaagctaaagaacctctcagttgaaatgggcaag
tcactgatacttgaatgcacatatgcggggagcccaaagattcttgtgaaatggcataaa
gatggccaggagatttactcttcatacaagtacaacattacgaccactgagagctcctgc
atactagaatgtctaaacagcgataaagaggctgctgggaaatacacttgtgaggtttcc
aatgatgctggacacgacatttgtgaagcagcagtgtccatattagaaccacctttcttt
attgagagtttggagcctatggaggtcactgctggggatgcagtttgcctgaagtgccag
attggtggcactcctgaaataaaaatatcatggttcaaggcagacggcaaagttcgttct
tctccgacctgcaagatggagttcttcaaaggcatcgcctgcctgaaactagctaaagtc
gctaaatctgacattggtgaatacacatgtaaggcagaaaacagcataggatctgccact
tccagctgtcacttaactgtacaagatgtgaaaacacccccgtctttccccaaaaagatc
actagcatcatgcaaattgaaggacagcctgtccagtttgagtgtcgtgttgcaggatcc
tctcctatggaggtctcttggttaaaagatggtgaagctcttaggagcgactcagaatac
acaatgtcttttgatgataactctgctgtcctaaacatagccaagggtgaaatgagacat
tctggagaatacacttgcgttgcaaccaatagtgttggaagtgcttcttgtagagccaaa
cttacacttcaagagccaagatatccacctgtgtttgataaaaagctcgtacctgtggac
gtgtcagtgggcgatactgtcgaactggaatgccatatgacaggatcaatgccaataaaa
gtcacttggtccaaggatcacaaagacatccgtacagggggcaattataagatatcatgt
gtggagaacaccccccatttgactattttgaaggctgataaggcagactctggccgttat
tcatgccatgctagtaatgatgttggaaaggactcttgttccactgaggtttctgtgaaa
gaacgcaaaattccacctagttttaccaaaaagccttcaacaactattgaggacattgag
ggcaaagtggtgaagatcgagggccgtgtagctggatcacagcccctgactgtcaactgg
tataaagatgggagagaaatcttcacttctgacttttatgatgtaaccttcaagagcagc
ctggctgtcctgtgcatcaaaaaatctcagctgtcagatagtggcacgtatgtgtgcaaa
gccaccaatgaagctggcactgcctcttttgaagtgtcagttcacattacagcacaaaag
gttccaccaagctttgacttgcctcttaaacctgtgactgtgaatgagggtgagacactt
accctcagctgccatgtacgtgggtctcctcctttaaagattcagtggatgaaggacagg
cgggagctttcttcatctgcaaacacaaagatcacatttgttgacggcactgccacattg
gagatgacccgtgtgtctaaaacagatagcggggattatctttgcaaagctaccaatgag
gctggtagtgagttctgcaagtctaaagtcactatcaaagataaaccaggtgctcctgcc
ccagcacaggcggcaccatcaccaccacaagaagttaagaaatttgacaacttgttcttc
attgaggtgccaaagagtgtccacatcgtcgagaaaggtacagctaccttcattgctaaa
gttggtggtgatcccattcccaatgtgaaatggatgaagggaaaatggaggcagatgact
cacggtggccgcatcagtattgaacaaaagggccaagaagccaagatggagatcaaagag
gtgaccaaatctgactctggccagtatagatgtgtcgcctccaacaaacatggagaaatt
gagtgcagcactgacttgaatgttgatgagaagaaagagacgactgtagaaatggtcaaa
ctgaagaagacaccatccaagcagaaaagccctaaagaggaaaaggatattgacattgtt
gagttgcttagaaatgttgatcccaaggagtatgagaaatatgctcgcatgtatggcatc
acagatttccggggtctcctacaagctatcgagtttttgaagaaggaaaaagaactagaa
agtggaagaccggaaggggaaattgttggaagagagtctgaagaggatttggctaaactt
gttgctgatttgcaaaagaggatggaacaaactgagcctgtcactgtggcacgtgacatc
acagaccagacaactactgttaagaaggaagctgtgtttgaatgtgagatcaagattaac
taccccgaaatcactctgtcctggtataaaggaacacaaaaacttgacagtggcgacaag
tatgacatcaaaattgtgggtgatcgtcacattttaaaaatcaaggactgccagacaaga
gatgagggaaattaccgtattgtgtgtggcccacatatctccagtgccaaactgacagtg
ttggaagctgaggtggaaaagcctatgcaggatgtggctggtaaggaaggccagacatgt
acattgacttgccagttgtctgtacctaatgtaaaaacccagtggtttagaaatgggaag
cttttagagcctcacagcagatatacatgtgctgtggccaattacactcagaagctctca
atcaaagatgttaggccagaagatcaaggagagtatacctgcaaatataaaaatcttgaa
acgactgccaatctttggatcgaagctgagcaaatacatttcaccaaacgcatccagaac
attgtggtgagagaacatcagtccgccacttttgagtgtgaggtgtctttcgacaatgca
gttgtaacatggtataaggacacttgggagcttaaagagagccccaaatatacattccga
agtgaagggcgacgccacttcatgatcatccgcaatgtttcctctgccgatgaaggcgtg
tactcggtcattgtcagattggagcccaggggtgaggctaaaagtacagctgagctttac
ctgtcaggcaaagaaattgaaatagaaagggttccttatgacatcccagatacatcaata
caagtgcctgaggcagctacattaaccattgaagcggagtcttcaatggagtactatcat
tatgaggaaaaaatggaaacgcaagagtatgtgagctgggcagaggagagtgttgtagag
gaaatatcatgcacagctccaagggtcccgatcgaagagtccgtcactagaaaaaccatg
ggaatgagagaggaggctcgaaccacagaattcgaggaacctgaaccatctaaaccagtg
gagctaatacctgaagtacctgagaaagccaaaattcctgtggaagaaatagttactgca
gttacagtgccagagccaattgaacgcccctcagcaaaagtgccacagcctcctgtggct
ccagcacctaaacctgaagagcctaaagctgtaccagtagctgagcccaaaccagaacca
aagcctaaacctgaaattaagccagagcctaaggctacgccggtgaagaaacctgagtca
cctccatccaaagttcttgaagaggaaacaaagccaaaaacacccatccaagaaccacca
aagaaagtgccagctaaacctgtggaagccattacagttccaactgaagaacctccaaag
aaagttcttgtagaagaaaagaaaccaaaaccaccagtccaagaaccaccaaagacattg
cctactaaacctgatgaagccattgctgttccaattgcagtacctccaaagaaagttctt
gtggaggaaaagaaaccaaaaccaccaattcaagaacccgcaaagaaattgccagctaag
cctgatgaaaccattgcagttcccattgaagaacctccaaagaaagtacttgtggacgaa
aagaaaccaaaaccacccattcaagaaccactaaagaaattggcaactaagcctgatgaa
cccattgcagttcccattgaagaacctccaaaaaaagatgtggacgaaaagaaaccaaaa
ccacccgttcaagaaccaccaaagaaattaccagctaagcctgctgaacccattgcagtt
cccattgaagaaccttcaaaaaaagttcttgtggaggaaaagagaccacaaccaaaaatt
caagaaccaacaaagaaattatcaactaagcctgatgaaacccatgcagttccaactgaa
gaacctcccaagaaagttcttatggaagaaaagaaaccaaaaccagcaatacaagaacca
ccaaagaaagtgtctgtgaaacctgagcaggccttcacaatagaagaacctcccaaaaaa
gaaccttccaagaagccaggagcccctctgttattggctacacagagagaagatttggtt
gaggaaaaacggcctaaaaaagagactgttgctatgcctaaaaagcaggaaattgtttcc
caaatggaagaaatggaacctcaaaagaaagatgttccactatttcctaaaaaggatgag
aaaagtttacctgaaaagaaagatgtacatcttacaaaggatgaggaaattgttcctcca
aagaaaaaggcaacaattcctgataaaaaggatgaggcaggtgtacctaaaaagaaagat
gtttctcctagaaaggatgagaaaattattcctctaaaaacggacatcacacttccttct
aaaaaggatgagccaattgaatatataaagaaagatgttgttattcctgctaaacagaaa
gataaaattgttcctcaaaagaaagaggtcactcctctttctaaaaaggatgaggcaact
gcacctaaaaagacagaaatgcttcctcctgctaaacaggatgaggaaatttttcctcaa
aagaaagaagttgctcttccttctaaaaaggatgaagcagttgaatctaaaaagaaagat
gtttatttttctgctaaacaggatgaggaaataatacctaaaaagacagaggttcttctt
cctcctaaaaaggaggaggcaattgaacataaaaagaaagacgtttcttatcctcgtaga
aaggatgaagagcatgaacctataaagaaagagggtcctcttccttcaaataaggaggaa
attgtaaatcaaaagaaagatgttccttttcccactaaacagagcgatgaactgttgctt
agaaagaaagatgttccaccttctcctaaaaaggatgacatagtacctcaaaagattcct
aaacaagatatatctcagactaagcctcatatgaaagagatgattcccacacaaattcca
gagaagacagaagaaaaagaaactttctccgtacaagtagttacacgtctacagaaggaa
gtggtacttgctgcagaaattctttcagaaaaagaagaaacggaagaaattttccttaaa
gaagaaattaaacatcttcaaaaggaagcttctcttaaaccaaagctggaagaaaaagaa
gatatattgcctaaaaagaaggaagtaattgccatgactaaaaaagaggaggtcataatg
cccaaaaagaaagaaattcctcttcttgctaaaaaggatgaagtaccccaaaagaaagag
gtgacccctacaaaagtggcagaaccagagaggaaaccatctcctgataagataccagag
acacctgtttctgtgaaagaagttgcacccccaaaagttgaaaagaaaccatctccagaa
cctgaaagaaagaaagaacctttgccagagcctaaggcaaagacggtttcaccagaagtt
aaagaggtcgataagaaagctgaagataaactcatctcaaaacccaaggaagagaagaca
attccaacaaaagtacctacacctaaagaaccagagaaaccaaaacctgcttcaaaagaa
gaaccagtaccaattgtcctaccagcggaagatggtgagaaggaaccagtttctgcacct
ggagcagtgaagaaaggcaaagttcttaaaattaaggaagaagaaggaagatttgaaatt
cccacattgaaaaaagctaaaagattatctaaagataaagacgaagatccagaaatggta
aaactgaaaaaagttctcaaaccagaagaagaggaatataaggaaagtccaaaagtgtat
gctgaggctcgcagagaagttgtgataactgaaagttatgaggcagaaatgcatttcgag
acttatgaagctaccaagagggatgtgaaaattcagcctgagattgacaaaaagagatct
gccgaacctgaccgagcaccacctgagataaaaccagaaagtgaagtagaagacaaagca
aagaaaacagcagttgcgagggttccaaaaaaagtcacaccagaggagcctggcttagca
ctaaaaaaggttaaaaagttaccattagacacaggagaacctgaatctgtcaaattaaag
ccgtttgaaaaacctgtgaaaacgcatcctgaaaccgagaaagacaccaaaaaagacgaa
aaaggaagggaacctgcaacttttgacaaaagtagggaaccgattacttttcagaaagga
gagctgcctttaaaggatgagaagacaaaggaaccagatgtgcctgtgaaaaaagaaaag
ccttctattcctgacaaaaaggagccagatgaagtcgctgttaaagctgtaaccagacct
gcaaaagatgaagtccctacagagcctaaagagaaattagttaagggtaaaggaaagatt
ccatctaaagaccaggaccctgagaaagttcaactaaaaccttttacgaagaagccttca
gctggatcacctaaagaaaaggaggccgcagagccaaaagacagaaaaccaattgagttg
tcaccgctaagtagggcaccaaaagatgatattaaaaaagagccaagtattccaaccaaa
aaaattgacagtcaagaaactccagacaaagctaaagaggttgagaagatttcaactcca
gtccctgtagaagacaaaacgacacctcctaaaaaggttaccccggtaaagaagattaca
cccaaggaagatgagaagaagcctattgttatcaaaaaaggtgttttacccaaggaggct
gaggagaaagaagaaataaaactaaaaccagttgaacgtacaaagagtggaatagagcct
gaaaagattccttcacccaaggttgagaaaacaaagccagctgaatcagttcctgtacag
aggaaacctattgatgatttaacaaaaacaccaaagacaatttcaccaaaagactcaact
gaagcagttatcttgaaaaaagtaccgcataagatttcacccaagcaggaaaaatctgag
gaaactcctcagatttctggagacgacaagataccagtcctgaaggagctatctccggga
gctgtagagttaagaaaagtctcaactcagtttgaggaagaagtatttgaagaagagttt
gaatatgaagctgaatatgaagatgaagaagaagaagcatggggatgggagcttgcttct
cgagacagttatggttcagagggctctgaagaacaatatttggaggaaggggcacttgag
actcctggaatgccagggggtagacgagagggaaagcccaaagaggaagctggaagaggc
agaggcttgaaaccaaaacaaactccttctcctggtgaaggtggaaagggtagagggctg
aagcctggcgctggtggtgacaaacctccaggagattcaccatttggtttccagctcaaa
gctgtccccttgaagtttgtgaaggagctcaaagatattgtgttgcaggaggctgagtcg
attggctcctctgctgtatttgagtgccagatctctccgtctactgctatcaccacctgg
atgaaagatggaagcaatctaagggagagtccaaagcacaaattcacatctgatggcaaa
gatcgcaagctgcaaatcattgatgtacagctttcagacactggagagtacacgtgtgtt
gcaaagcttggcaacaaggagaagacctcaactgctaagcttattgttgaagaattacca
gtgaaatttactaagactctggaggaggaaatgtctgtgattaagggacagccgatgtac
ttaacctgtgagttgagcaaggacagagatgtggtctggaagaagaacggaaaagagctc
aagcaaattgctggcaaagttcaagtcaatgttattggactgcagcgatcagcaacgatc
caggacaccaatgatgatgatgctggtgtttatacctgcgagtgcgaagacatcaaaaca
caagccaatgtcaaaattatagaaataatcagagattggttgacaaaacctttgagggac
cagcatgtaaaaccaaaagctaccgccacattcaaatgtgaactctacaaggacactccc
aactggaagtggttcaagggagatgaagaaattcccactgaccctacgaacaagactgat
gtcaaaaaagatggcaaagagatcacacttacagtcaagaatgctcaacctgatgatatt
ggagagtatgccatagaagttgagggccgcagatatacagcaaaactcactctcggagag
cgtgaagctgagattctgaagcctcttgctagtgtggaggtggttgagaaaggagaagcc
aactttgatactgaaatttcagaagatgatattcctggagaatggaaacttagagggcag
gttctgacaagatcaccgacatgtgacatcagagctgagggaaataaaagattccttact
ttgaaaaatgttcaacttgaccaggctggagaggtttcttaccaagctttgaatgccgtg
accagtgcaatgctaacagtcaaagaaattgaaatggacttcacagtcccattgagggat
gttactgtgcatgaaaagaaacaggctaagtttgagtgcacgatcacgaaagatgtgcca
aaagtattgtggttgagaggatctgatattgtaacatcagaccaaaaatatgatatcatt
gatgatggaaagaaacacatgttggtcataaaccactgtgaatttgaggatgagggagaa
tatactattgaggtgttgggtaaaacatcaacagccaaactgacagttgagggtatgcgg
ctgaaattcgtctcaccaatatcggatcaaactgtaaaggaaggtaaaacggctcggttt
gagcttgaactatctcatgatagtgtaccggtgacatggtacaaaaatgaaacaaaactg
catccgagcagaactgtacttacgcatgttgatggaaagaaacatatattagaaatcaag
gatgtcactctagatgatacttgccaaataaaagcagaagctaaaggaatgtcgacaaca
gcaaacttgacggtgctagagggagatgcctgcttcacagttaaactacaagattacact
gcagttgagaaagatgaagtcattcttgactgcgagttaagcaaagacgtacctgtgaag
tggttccacaatgagactgaaattaaagcctccaagatggttgccataaaagttgaagga
aaacgaagaatcctaaacatcaagaaggttgaggacaaagacaaaggtttatatgtttgc
gactgtggaacagacaagacttcatccacactgaacattgaagcccgtgatatcaaagtg
gtgcgaccaatgtatggtgttgagctctttgatggtgagacggcccgatttgaagtggaa
atttctgaagatgatgtccatggccaatggaaactgcaaggagaagttctctctccatca
cctgatgttgaaatcatcgaagatggtgccaaacacaccttaactttgtacaactgcaaa
gtgtcccagtctggagaggtttccttccagggtgccaatgcaaaatgttctgcaaatcta
aaagtgaaagagcttccaatttcatttgtaacacctcttgctgatgtgcatgtatatgag
aaggatgaagcacggtttgagtgtgaaatctcaagacaagcgaagagcttccgctggttg
aaaggatctcaagagattaagactgatgataaatttgaggtacttcaggagggcaagaga
cacattctggtagttaaagctgctgcctatgaagatgaagcgaagtacatgtttgaagct
gaggacaacagaacatctgccaaacttgttatccagggaattcgtctggaatttgtcaga
cccattaaagatgtcactgttaaagagcgtgaaactgcagagttcagcattgaactctca
cacgagaaggttcaagtcacctggtacaagaacgatgttcgtctgcatccaagcaaagtg
gtccacatgtctgaggatggcaagattcatactctgtccttcaaagaggtgtctattgac
gacacatctctcattaaagttgaggctctcggaaaaacctgtgaggcaatgctcactgta
cttgagggagaaccttactttaccaccaagttgcaggactacaccgcagtcgagaaggat
gaggttgtcctgatgtgtgaagtgagcaaatcatctgctcaggtgaaatggttcaaagat
ggcaatgaaatcactccctccaagaacgtcctcatcaaggctgatggaaagaaacgcatc
ctgacagtaaagaaggcagaaaagggaaacattggcgaatatgtgtgtgactgtggctct
gacaaaaccgcagccaaacttaacatcgaagaacgtgatattaagattgtccgtccactg
tacagtgtggaggtcacagagacagagactgctcgctttgagactgaaatctctgaggaa
gatgttcacggtcactggaaactcaaaggagacgccctgcaccaatcacctgactgtgaa
attaaggaggaaggcaccaaacacatgcttatcctttacaatgttcgcatggacatggct
ggtgctgtggacttcagtgctgctaatgctaaatccaaagctcagctcagagttaaagca
cgagtgataggcctcttgaggcctctcaaggatgtaacggtgacagcgggagaaactgca
acctttgactgcgaactgtcttatgagggcatacctgtggaatggttcctagggggtaca
aagctggaaccaagtgacagagtggtgacccgggctgaaggcagatctcacacgctaacc
cttagggatgtaaagctgacagaggccggggaagtaaaactcaccgctaaggacttcctg
acacaggctcagctcattgtaaatgaaccaccagttgaattcaccaaacctttggaggac
cagactgtagaggaagaagccactgctgaattggagtgtgaagtctccaaagagaaagca
gaggtcaggtggtttagagatggacaagaaattcgcaaaaccaagaagtatgacatggtc
gctgatggctgtaaaagaaaactcgttattcatgactgcacacttgacgactctaagacg
tacacctgtgatgctaagcatttcaagacttcagccttcttaaatgttgagcctccatat
gttgagttcacaaagccactccatgatgttgaggtcaaagagaaggaatctgccagattt
gaatgtgaagtgtctcgtgagagtgcaaaggttcgctggttcagagatggcaatgaaatc
agaaaaggcaagaaatacgagatgatttctgaaggagtaaaacgcattctcatcataagc
aagtctgtctttgatgatgaagcagaatatgaatgtgatgccaggacctccaaaagctct
ggcatgttgactgtcgttgaggaggaggctagattcacaaagaacttggctaacattgaa
ggcactgaaaccgacagtgttaaactgatttgtgaggtttccaaacccagtgcagaggtt
acatggtacaaaggtgaccaagaattgcctgaagttggtagatatgagcatattacagat
ggcaaaaagagaatcctcattattaagggtctccgtatggatgatgctggagagtaccac
tgtaaactgcccacctcacaaaccacaggaaacctgaggattaatgaacttgccgctgag
ttcattgccaggcctcaaaaccaagaggtggttgaaggtgaaaaggcacaatttgtgtgc
tctgtctccaaagacacatatgaagtaaaatggcttaaagggaatacagaacttcaatcg
gatgacaagtatgaaattatttctgagggcaaaaagagagttcttattgtcaaaaactgt
gaactcaaagatgagggaggctttgtagtcctcattggaaccacaagagcttcagctgat
ttgactgttcttgaaaagctgaggattatcactcctctcaaagacacaaaggcaaatgaa
gggcaagagactgtcctcaattgtgaagttaacactgaaggggccaaggccaaatggcta
aagaataatgagacattattcgaaagcagcaagttcatcatggttcagaaggacaatgta
ttctctctgagaatcaaagatacccaaaagtcagatgaggcaaactacacaattacactg
accaaccagcgtgctgaacaagccaagagctctgccaacatcactgtgcatgaggaagat
cttagaattgttgttccacctgaggatgttgacacgcaggagaaaaaggccatcagtttc
acatgcaaggtgaatagacaaaacgtaactgtacagtggatgaaagcaggccaggaaatc
actcttagcaagagaattctgtatcgcgtggacaaggaaaagcacactttgacaatcaaa
gactgcagccttgcagatgaaggtgaatacactgtaattgctggtcctgacaaggccaca
gccgaactgatcatcagtgaagctcccactgacttcaccgctcaactcagtgaccaaacc
atcactgaatttgaggatgctgaattcagttgtgaacttactaaagagaaggctgatatc
aaatggtacagagatggcagggagatccgagaagggcccaggtaccaatttgagagagat
ggcaaaacatgcagactgcgtataaaggagtgcagaccagatgatgagtgtgaatatgca
tgtggtgtagatgacaagagaaccagagctcgtctctttgtcgaggagaccccggtggag
attgttagaccacccacagatgtgtttgagccaccaggctcagatgttgtatacgaagtt
gagctcaacaaagacagagttgaggtcaaatggctgaggaacaacatgaccattgttcaa
ggtgataagtaccagatgatgagcgagggtaagattcacaggcttcaagtgtgtgaaatt
aggccacgtgatcaaggcgagtacagagtcattgccaaggacaaagatgctagagcaaaa
cttgagcttgctgctgtaccaacaattaaaacattggatcaagatctggtgacagatgct
ggaaagccttttgttatgggggttccatacaatgcttacccccttgcagaggctgagtgg
ttctacaatgacataagtcttccaaaagacaatattcacacctctattgataggacagaa
tacaggcttaaggaccctaagaaatcagaagagggacgctataagatcatcgtccagaac
aaacatggaaaaggagaggctttcataaacctcaaagttatcgatgtacctgggcctgtg
aagaaccttcaggttgttgacactgctgatggtgagatcagcattgcttgggaggagcca
gaaagtgatggcggcagcaagatcttggcttatgtggtagagagacgtgatgttaaacgc
aagacgtggactctggccactgactgtgccgacagcacagaatacactgtaactggcttg
cagagagactccaagtacctgttccgtgtctgtgcacgcaaccgagttggaagtggacct
aatgttgagacagacaaagctgttcaagcaaagaataaatttgatgttcctgatgcacca
cagaatgttattgttggaaatgtcaacaagtttggtgctacagtttcttgggaaccacca
ctgttcgatggtggatctgaaatcacatcatacattattgaacttcgtgacagaacctct
gtggtctgggctccagttatggtgaccaagccacatgaacgttcagccatcattaatgat
gttattgaaaacaaagagtacatcttccgtgttaaggctgagaacaaggctggaattggg
aaaccaagtgctgctactaacccagtgaagatcatggaccccattgagaggccgagccct
cccctaaatctgacccattctgagcagactaaggactcctgtttgttgacatgggagact
cccttaaaaaatggaggcacagctatcactggctacatcattgaaagatgtgaagaaggt
acagacaagtggctcaggtgtaatgccaggctttgtccagacctgctctacaggatgtca
ggcctgaagtttgggaaaaaatacagctatagagtaattgctgagaatgcagcagggcag
tctgacccctcaaacatagttggacctgtgctggcagatgatccacactatgcacctact
cttgacttgagtgcttttaaggatggtctggaggtttttgtccccaaccctctctcaatc
cgcgtccctatcactgggtacccagttccaactgcaaagtggacgtttggcgaaaatgca
ctgacagctggtgatcgtgtatctatggtcacaaagtcaaccttcacagagcttgttata
accccaagtgtgcgtgctgacaaaggaacatactctttgaccctggaaaatgatgtggcc
agtgtctcaggagagattgaagttaatgtcattgcatctccaagtgcacccaaagactta
aaggttgcagaagtaaccagaaagcatgtccacttgatgtgggaggcacctgaacatgac
ggaggcagtcctattactggctaccaggttgagaagcgtgaagtgtccaggaagacatgg
gtgaaagtgatgtctggtttgcaagaccaggaatatacagtcacagatgtggttgagggc
aaggaatacttgtttagagtaattgcctgcaacaaatgtggaccaggtgaacctgcctac
attgaggatccagtgaatgtgtcttcacctgcaactgtaccagacccaccagaaaatctt
aaatggagagacaagtctgctagcaaaatcttcttgtcatgggagccacccaagtgggat
ggtggaactcctatcaaaggttatattgttgacaaatgtcaacgaggcactgacaagtgg
gagccatgtggagaccctatgcctgagcttaagttcgaagtcactggtctcattgaagga
cagtggtatgcttatcgtgtgcgggctttgaacaaactgggtgctagtaagccttgcaag
tcaacagatgagatcttggctgttgatcctaaagagcctcctgagattcagctggatgca
aaactgctagctggtctgactgctaaagctggcacaaagattgaacttccagctgacatc
actggtaaaccagagcctaaagtcaaatggaccaaggctgacctagtccttaagccagat
gacagaatcaccattgatacaaagcctggccattcaactttgtccatcgctaagaccaag
agggatgacacagccacgtatatcattgaggcagtcaacagcagtggccgtgcaactgca
actgtggatgtcaacattttagataagcctggtcctccagctgcctttgacatctctgaa
attaccaatgagtcctgcgtgttggcttggaatcctccaagagatgatggtgggtcaaag
gtgaccaactatattgttgagaggaaagctgtagacagtgaaatctggtacaagctgtcc
tccactgtgaagcagaccacctacaaggccaccaagcttgtggctttcaaggagtacatc
tttagggtgtatgctgaaaatcagtttggcattggtgccccagctgaacatgccccaata
attgccagataccctttcgatacccctggtcctccatacaaattggaaccatcggatatt
gcaaaggatgccgtaactctgtcctggtatgagcctgatgaggatggtggaagtcctatt
actggatattgggtagaaagatatgagcctgaccatgacaaatggatcagatgcaacaag
ttgcctatcagggatacaaactttcgagtgaaaggactacccacaagaaagaagtacaag
ttccgtgttttggcagagaatcttgctggacctggaaaaccaagcaaagagacagaccaa
attttgattaaagatccaattgatcccccatgggctcctgggaagcccactgttaaggat
gtagccaaaacctctgctttcctgcaatggacaaagcctgaacatgatggtggtgcaaag
atcgagtcttacattgttgagctcctcaagagtggaactgatgagtgggtccgtgtagct
gataatatcccctctcttgagcacttcctgaagggattgatggaaaagcaagagtactca
ttccgtgtcagagctgtcaacgtagcaggcgagagtgaacccagtgaaccaagtgatcca
gtgctctgcaaggagagactcaatcctccatcaccaccaagatggcttctagtagtttct
agtagcaggaacagcgctgaactgaaatggactgcacctgagagagatggtggctctcct
atcacaaactacattgttgagaagagagatgtcaggcgcaaaggctggcaggctgtggac
accacagtgaaggagctgaagtacactgtcaccccactaaatgaaggatctctatatgtg
ttccgtgttgctgctgaaaatgctgtagggccgagtgaattttgtgaacttgaagactct
gttcttgccaaggatactttcggtacccctggacctccatataatctgactatcactgaa
gtttccaagactcatgttgatctgaaatgggaagcacctcagaatgatggtggaagacct
gttttgagatatgtcattgagaagaaggagaaacttggtacccgttgggtgaaatctgga
aagacttcgggtcctgactgccattacagagtgactgatgtaattgagggcactgaagtg
cagttccaggtctctgctgaaaacgaggctggagttggtcacccaagtgaacctactgac
attgtagtcattgaggatccaacaggcccaccatcaccaccacaggaattgcatatcaca
gaggcagcaagagatcatatctgtattgcctggaaggcaccagaaaagaatggaggaagt
cccattattggttaccatattgaactatgcgaggctggaacagagaagtggatgagagtc
aactctcgtcctgtcaaagagttaaaatacagagcaggagatgaagagggaattgttcct
gaaaaggagtataccttcagagttcgtgctgttaactctgtgggtgccagtgagccctct
gacatttctgagaatgtatttgccatagactctgactgtagcccaacactagacttccag
accaaggatcttgttgttgtagaaggtgaaaagatgcacctcccaattccatttagggct
gtgccatcacctaagattacatggcacaaagatggaaatgaaatgaaggctgatgacaga
accttcttcagagctgagtacacatcctgccatctggaagttccaagctgcttacacgct
gatgctggccaatacaaagttaccttggaaaacagaaatggtgccactagtggaacgatc
aatgttaaagttattggtcttcctggaccatgtaaagatattgttgctagtgaaattacc
aagagctcctgcaaggtgtcctgggaacctccagactatgatggtggtagccctattctc
cactacgtgctgcaacgcagagaagcaggcaggagaacctatgtcaaagttatgtctggc
gaaaacaaattgagttggcctgtaaaggatctcattcagaatggagagtactacttccgt
gtcagagctgtcaacaagattggtggtggtgaatttattgagcttcgcaaccctgtaatt
gcagaagatcagaaacaacgtcctgatccaccagttgatgtggaaacccataacccaaca
tctgagagtgttacccttacttggaagcctcccatgtatgatggtggaagcaaaattatg
ggttacattcttgagaagatgatgaaaggggaagagaacttccagagatgcaatgacttc
cttgtgccggtgttgtcttatactgttaaggggttgacacatgaaaaacaatatcagttc
cgggttcgtgcagagaatgcagctggtgtcagtgatccttctcgcagcacacctttgatc
aaagccacagatgcaactgatcgtcctaaggtattccttagcggtagtctacaatcaggc
ttggctgtgaaacgaggtgaagaaatcagattggatgccaacatctctggatttccctac
ccccaaattacatggatgaggaacaatgcaacaatttggccagaaccactaaagaagagg
ccagaaaggcccattaagaagaagaaggaaaaggaggaaaagaaggaggagggagcagaa
aagaaagaggcagatgcagaaaagaaggaggaagacaaagaggcaaaggaggaggacaaa
gaaaagaaagaggaaaagaaggaggaagaaaaggaaaaagaaaaggaggtggaggaaccc
gaagagcctgaagaagaataccatccaagcttaaatgaacgtcttaccattgaatcaaag
agaaagggtgaatcctatattattataaaagatactatcagaggcgatcatggtgttttc
acaataaaagtggaaaatgatcatggaactgcctctgcctcctgtgaagttaatatcctt
gatactcctggacctccagtaaatttcaaatttgaagagataaggaagaactccatcctc
tgtaagtgggatcctcctctggatgatggtggtagtgaaatccttaactacatattggag
agaaaagataactccaaggctgagcttggatggatcactgtaacatccatccttagagga
tgtaaatttcttgtgccaaaacttattgagggcaaagagtacctcttccgtgtcactgca
gaaaacaaatatggtcctggaaaaccatgcatcaccaaaccagtcattgcaaggaatcca
ttcgatcctccagatgcaccggagaaacctgaaattaaggatgtcactgccagcagcatg
tgtgttacctggttagaacccaatgacaatggcagcgccattgagggatactgggtagag
aaacgagaaatcaacagcacacactgggcaagagtcaaccgcactatggttcctgacttg
gaaataaatgttgaaggccttcttgaaggtctgacatatattttcagagtatgtgcagaa
aatatagctggacctggaaagttcagccccccgtcagaaccaaaaacagcacaggcacca
atcatgcctcctggtccaccaattccaagaattgttgacacctcagactattcaattgac
attgaatgggatcctcctgcggacaatggtggcgcagaggtctttggttatcatgttgac
aaacttgttgctggtaccaaggactggtcacgggctacagagagacctcacaaaacccgc
acatttactgtatatggtgttagagaaggggctaaatacatagtccgtgttgtggcaatc
aattgtgctggtgaaggagaacctggtttgactgatgcagtaattgtgagaaaccctgca
gaggttccagtcatcgagcttgatatctctgtgagaaatggtgttgtcgttagagctgga
gaaatgctgagaattccagcacatgtgactggtagaccccctccatctttgaaatggaca
aaggatgatggtgacttagaaaaagatcgtatggaggttgaagaagctggacaggacagc
accgttgtcattaaaaccacaaagagaagtgaccatggcaaataccaaatccaagcagca
aatccaagtggtattaaatctgcatggaccagggttgaagtcatggatgttcctggacca
gttcttgacctgaaacctgttgtggttaccaggaaacttatgatgttaaattggtcagat
cctgacgatgatggtggtagtgatgtgacagggtttatcattgaaaggagggaaccaaag
atgcacacatggagacagcccattgagacgccttcatccaaatgtgagattgtaggtatt
attgaaggacaggaatacattttccgtgttgtggctaagaacaagtatggatgtggacct
ccagtcgatcttggacccatccgtgctgtggatccacaaggtccaccaacttctcctgaa
aagttccactatacagagagaaccaagtcctctgttacaattgaatggaggcctccccgt
aatgatggtggtagtccaatcattggctacatcattgagaaaaagcgacaagatcaaccg
gccttccagcgggtcaacccagagctgtgcactgttcaaattatgacagttgacaatcta
gatgagcttcatatgtatgagttccgtgcaaaggctgtcaatgcatttggtgaaagtgag
ccttcaataaccatgactgttgtcattcaggatgatgaagtggctccaagtttgcgtatg
ctgaaacacttcaagggtgatttgattcgagtaaggaaaaatgagcctattgagatgcct
gcagaagtcactggtttgccaatgccaaagattgaatggctgaaggatgatgttgttatt
gaaaagcctactgagaaacttctatttgaaaccaaagagattgacagagtgacgtcacat
acaaaactgtccattcctggtgttacaagactagacaagggcacatacactgttactgcc
tccaatcgtttgggaacgctgagtcattcggtcacagtggaagtgttggatcgcccaacg
ccaccaagaaatgttgctgtttcaagcatcaaagctgagtcttgcaaccttagttgggat
gccccattggatataggtggcagtgagcttaccaactacattgttgagatgaaagacctt
aatgttgaagatcctgaaaaggctgagtgggtgcaagttactaagtctattattgaaaag
agatatggggtgtggaacctggtaactggtggcaactataagttcagagttaaagctgag
aacaagtatggaataagtgaggcatgtgaaacagaggaggttgagattaaagatccttct
gctctgcctggcccgcctgagaaggtcacaattgcagagcgctccaagacacatatgcta
ttgacatgggaaccacctaaggacagtggtggttctatgattactggctactggcttgag
aagcgtgaaaaaggcacttcgtattggtctcgtgtgaataagatcctggtttcaaaacgt
ggcatgaaaggctgggaataccaggttacacgtctctttgagggagtagagtatgaattc
cgtgcaatggcttgcaattctgctggtattgggccacctagtgccatctctgagtctgct
gttgctgacgatcccctgactccacctagcatgcctgcagctcctgagattgctgacaaa
accaagcatagtgtcacccttgcatggaccccaccagctaaagatggtggccgccccatc
aagggttacattattgagattcaagatgaaggtacttctgagtgggccagggtcaatgat
gctgaaaatctacatccttctactgtgttcaccattccaaacctcccagaacttaagaaa
tacagattcagaatcattgcagtcaatgaaattggagagtctgagcctagtcccagaacc
agcgaagttcgcatagaagatattaaaactgcaccaaagatcttcatggatatcagtgct
gatgaactgctgtgtgttcgggctggaactccatttaagattccagctaccatcacagga
cgtcccgctcctaaagttacatgggaatttgatggaaaagcaaagacagaaaagaaggat
cgtctccatattttaccagtagattcacaggttgaatctacagataccacttcagttgtt
acagttcctgtgagtttgagaagtcattctggcaggtatacaattacagcaaagaacaaa
tcaggacagaaacatgtcaacgtcagagtaaatgtgctagatgttcctggagcacctaaa
gagcttaaagttactgatgtcaccagaaccacaatgagactcatttggaagttgccggat
aacgatggtggtgagagaatcaagagttactttattgagaagaaggctgttaatggaaag
gcttggacggttgccaatgctacttgtgccagcatggcctttgtcgtgtccaacctcctt
gagggacaggactactttttccgtgttcgtgcggagaatcgccttggatttggaccattt
acagagactacagaacctgttcgggctagggatcctatttatcctcccgatcctccaacc
aaagttaaaattaaccttgttaccaaaaatactgttacccttacatgggtgcctcccaag
aatgatggtggtgcaccagtaaagcattacattattgaacgtctgagctgggacacaagt
ggtccacagaaagagacttggaaacagtgcaacaagagagatgttgaagagactaccttc
atcattgaagaccttaaagagggtggcgagtatgagttccgtgttaaagctgtaaatgaa
gctggtgcaagcagaccttctgttaccgctggaccaattgtcattaaggaccagacatgt
gctccaagtattgatctcagagaggctttggaaggcgcagaaggatttgatgtcaacatt
gttgccaggattcaaggctgtccattcccatctcttgtctggcacaaagctccacaagac
aagcctgatgacaaagttcctgtacagtatgacaaacatgtcaataaacttgtctctgat
gaaaaatgcagcctgtttatccagcagtcaaagagagatgacagcgcaatgtacacactc
acagcaaccaacagcttgggcacagccaccaagagcattaagctcagcattttgggacgt
cctggtgtacctgtaggaccaattaagattggggaagtttttgctgaaaggattggcctc
tcctggaatccaccagcagatgatggtggttccaagatcacaaactatgttgttgaaaag
cgtgaggaaaacagaaaaacatgggtccatgtctctagtgatccaaaggaatgccagtac
atagtacaaaggctaacagagggccatgaatatgagttccgtgttatggctcagaataaa
tatggagttggaccacctttgtacagtgaacccgagaaagcacgaaatctcttcactgtg
cctggccaatgtgagaagccaactgtaacagatgtttcagctgaatcaatgacagttaac
tgggatgagcctgaatatgatggtggctctcctgtaactggctactggctagagcgcaag
gaaactacaggcaagcgctggacaagagtgaatcgtgagcctatccgaattaggactcta
ggtgtttcacatattgtgacaggactcttggagggagcgatctaccagttccgtgttatt
gcaattaatgcagctggatgtggcctacctagtttgccttcagatattgttgcatgtaga
gaccccatagcacctccaggtcctccaacgccaaaagtaacagactgtaccaagtcaact
gttgatcttgaatggattcctcctcttaatgatggtggatctatgatcaccggttatttt
gtagagtacaaacaagaggggcaagaggaatgggagaaggttaaagacaaggaaatcaga
ggcaccaaatttgttgttcctggacttaaagagcttggactttatagatttagagtgaga
gctgtaaatgctgccggtgttggagaacctggtgaagttgctgatgtgattgaagtcaag
gacaggacaatccccccagaggtagacctggatgcaactgtcaaggaaaagatagttgtt
catgctggtggggtaatccgcatcctagcttatgtttctggaaagcctgcaccagagatt
atttggaatagagatgatgccgaattgccaaaggaggctgctgttgagacaacttctata
agttcagctttagttatcaaaagttgcctgagacaacaccaaggcatttatacattaact
gctaagaatgcaggtggagaaaggaaaaaagcagtcattgttgaagtattggatgttcct
ggtcctgttggtctacccttctctggtgagaatcttaccaatgactcttgtaaattgaca
tggtactcccctgaagatgatggtggctcagctatcaccaactatataattgagaagaga
gaagctgaccgcagaggctggacttcagtgacatatactgtcacaagacataatgctgtt
gtccagggtctcattgatggaaagggttacttcttcagaattgcagctgaaaatataatt
ggaatgggtccattcactgagactgcagctccagtcgtcatcaaggatccactctctgta
cccgagcgccctgaggatgttgaggtgacagccatcacaaatgattcaatcagtgtcgca
tggagatctccaaaatatgatggagggtcagacattacaagctatgttcttgaggttcgt
ctaatcgggcaggacaacttcagccgcattgccaaagaggacaaactcatggatcgtaaa
ttcacccatgctggtcttaaagagggttcttcttatgaattccgtgttagtgctgttaat
caaattggtcaaggcaaaccgtcattcagcacaaaaccagttacatgcaaaaaagagttt
gaaccaccaaaccttgatttggagttccgtgacaagcttgttgttcgtgttggggaaact
tgcatcattcaaagccgatacacaggcaaaccggaaccaactattaagtggttcaaaaat
gatgaagagcttcaggcaaatgaagaaattgctcttaccactgcaaagaacagattgagc
ctgactatcgaaaaggcaaaacgtgatcacagtggaaaatacatggtggttttggaaaac
tctattgggacacgcaagggaatatgtactgtcaatgttgtcgaccgtccacaacctcca
gaaggccctgttatctttgatgaaatctacaggaattatatggtcatttcttggaatcct
ccactagatgatggtggagctgctatttctaactacattgttgaaaagagagacaccaac
agggatctgtggatgcctgttacagaatcttgcacaaggacatcatgcaaagttccaaaa
ctgattgagggaagagaatacattattagaatctgtgctcagaatattcatggtattagt
gatccattgctctctgctgagacaaaggcaaaggatgttttcaaggttccagatgctcca
caggcacctgtagtaaaagaaatctataaagatacagctctgatttcatggcttcaacca
gctgatggtggcaaaccaatcacaaactacattgtagaaaagaaggaaaccaaggccaac
atgtgggctagagctggaaaagatcgcattttccccaacacagaatactgggttcctgat
cttctcaagggttgcgaatatgaattccgtgtcatggcagagaatgtgattggcattggg
gaccccagtccatcttcaaagccaatctatgctaaagatcctatagtgattccaagccca
cctgtacttccagttgcaattgataagacaaaagagtctgttactctttcttggcagcct
ccaaaagactgtggcagaggcaaaatctttggttatctgctagagtatcagaaagctggt
gatgaggaatggcttcaagttaatcagacacctgactcctgcccgagcactacatttaag
gttatcaaccttgaggatggtgcactttatagatttagagtgaaggcagtgaatgctgct
ggtgaatcagagcctgcatatgttccagagcctgttcgagcacaagacagatttgagccc
ccagaacttcaactggatttgggcatgcctcgtgagttgaaagcaatggctggaacccat
attaatatcatggctggaatcaaagggatgcctttccctaaagtcacctggaagaaaaat
gaggcggatgttcccacaagagcagagattgagacatctggaactacaactaaactagag
atgcgctattgcaaccgtactgattgtggagattacacacttactgttgaaaatccagct
gggtcaaagatagccacatgcactgttcttgtacttgacaagcctggaccagttcagcac
ctcagagtatctgatgtcagaagtgattctgcccaactgtcttggaaagatccagaagac
aatggtggtgcacgcatcaccaattttgttgttgagaaaaaggatgcagcatctcctcaa
tgggtgccaatctgctcatcatctaaaaaacgtagcatgatggctaaacatttgattgaa
ggaacgtcgtacatgttccgcgtggcagctgaaaatcagtttggaaggagtgaatatgtc
gagacaacaaaagctatcaaagcaatgaatccactgttcccacctggtccaccaaaagac
cttcatcatgtagatgctgacaagactgaggtgtggcttcagtggaactggcctgatcgc
acaggaggaagtgacatcacagggttcttggttgagtatcaggaagaaggtgaaaaggat
tggatagtttttaagactgtcagcattcctgagtgccatgtgacaggactggaagaggga
aagacctacaggttccgtgttaagacggaaaatgcaattggtctaagtagaccagacacc
actgtgccagttctttgtcaggaaaaactagtaccgcccattgttgaggtggatgttaag
ttgattgagggaatcattgtgaaagctggaagcacaattagattgcctgctttaatgaga
ggccttcctgttcccactgctaaatgggtcattgatggagaggaaatcaagagtgaaggc
aataccaaaattgacactgacaacttctccactgttttgagcattgcagactgcacaaga
aatcacactggaatatatatactcacagtatctaactctgcaggaagtaaaactgtttct
ctgaacgtcactgtgcttgacgtaccagctgcacctataggccctgttaatattcttgag
gtaactcctgactccatggttattgactggcgccctcccaaagatgatggtggaagtcct
gtcatgaattatattgttgagaagagggaatcaaataaggaaacttggggaggagtaagt
tctggcagcacttctacaaggctgaagatttctcgtctgcagcagggagttgaatatgtt
gtgagaattcgtgctgaaaataaaatgggaattggtgcagctcttgaaagtgcaccaact
gtagctcggcaccagtttgaggcccctggccatcctggaaaacctgtagcttctgatttg
tctgaagatgcgcttacacttggatggacaatgcctctgtttgatggtggcagtccaatc
agtggttacattattgagcgaagacataaaggtggcaaatggattagagtgaataaaact
ccttgcaaagaacttagatatagagtgcttggtctttttgaaggtaatgaatatgagttc
agagtatttgctgaaaatattgctggctttagtggaccttcacctgtctcagatcctgcc
aaaccttgcagaccaataactgttccaggacctccagttaaccctaaggtaaaagactac
agctgcacatatgctgacttagtctggatcaaacccacaaaagatggaggcagtccagtc
ttgggatatattgttgaatgccagaaaggaggtgctgagtgggagaaagtcaataaggat
gatctgattaaacagtgtgcttatagggtgaaaggactgactgaagacactgagtacagg
ttccgtgttaaagctgtgaacatgattggagaaggtgagaccagagaaatcccagagtcc
gttattgctaaggatatcatcattcctccggaaattgagatggatgccacatgccatgaa
cgtgtgactgttcgtgttggtcataacattaatgttgtaggatatgtaaaagcaagacct
gatccagaaatcacttggagcaaaggtgaaagcattttggaaagggacaagcgcaccatg
cttacaaacaacttcccagtcgtgcaaatgcgtatcaaggaagcaaccagagcagaccat
ggaaagtatgtactaaaggctgttaatgaagctggagaggcctcagcaactattacagta
aatgttctggatagacctggtcactgccagaatctaaagatgacatatgtaactaagaat
tcttgcatggtgtcctgggatgctcctgaggataatggaggtagtgagataacaaattac
attgtggaatgccgagagccaagtatacgaacctgggcaatgatctcatctgactgcaca
aatcgcatggtaaaagccaagctcatggaaaaccatgaatatttattccgtgtgtctgct
gagaacaagtgcggtccaggaccagctacagaaaccaaaactcctatccttgcaattgac
ccacttcagaagccaggcgagccagagaatttccatgtcggtgatattggtaaaaacttt
gttttccttaaatggagaaaaccagattatgatggtggcagtcctaaccttggctactat
ctggagagaaaagcaaaagacgctgaagcatgggagaagttacatgaaggagttctgaaa
gagacattcttcatggtagacaaatgtgttgagaaccacatctatcaatttagagtccag
tcaaccaatgatggaggagaaagtgcatgggttagcacttctgatattgtcgtcaaagaa
gaaattcagaaaccagttcttgacatgaaatttgttggcactattgtggtcaaagcaggt
gaatcagttagacttgaagctggacttagaggaaaaccacagcccacggttacttgggtg
aaggacaaggctacgggtgataatccaaggatcagcattgacaccggacatgattactcc
aaattccttctgactaaaaccaagcgtagtgacactggaaaatatgtagttactgctaca
aacccagctggttcattcacagcatatgccaacgttacagtgctagatataccaggacct
gtcagagatatgaaaatttctggcatttccacagacaagtgcagagttgcatgggatcct
ccagaggatgatggtggttgtgaagtggacagctatataatagaaaaatgtgagaccaga
agaatggtttggtccacttactctgcatctctcgtcacaaactactgtaatgtaacacgc
cttgttgaaggaaatgagtacatattcagggtcagagcagaaaacaagatgggaactggg
ccaccaatggagagcaggcctattattgctaagacacaatacaacaggcctggtccacct
gatgcacctgaggtaaccaaaattggtaaggatgagatgacagtggtatgggctccacct
gaaaatgatggtggaaagtctattactggttacattctggaaagaaaagaaaaacgtgcc
gttcgctgggtcccagtcacaaagagccctatttctgagagacgtatgaaggttactaat
ctgatccctaaccacgattatcagttccgtgtcaaagctgaaaatgaagttggattggga
gaaccaagcaaagcatctagacccatcactgcaaaagatccaattgagcctcctggccct
cctggtagccttaaagtagttgacagcacaaagacatcgattacacttagctgggcaaag
cctgtgtatgatggtggagctccagttattggatatttggttgaaatgagggataaggtg
gaaatggaaggtgaacaagtacgtgatccagaggaaggctggaagaaatgcaatacttct
ggacagcttgtcttaactgaatacacaatcagtaacttggatgagagacaggaatatgaa
ttccgtgtgtctgctcaaaaccaagttggtatgggccgtcctgcaaatgtcaaggatgct
gtatctccaaaggaggtccatgaacatccagagattgatcttgatgccagtctaagaaag
ggtcttagtgtcagagcaggatgtcctatcagactttttgctacaataagaggaaggcca
gcacctaaagttacttggaagcgcattggtgttgacaatgtcataaggaggggtcacgtg
gatcagattgatacaatgaccttcctcgtcattcccgaatcctcacgagaagactctggc
aaatactctttgactctttcaaatccctctggagagaaggctgtgtttgtccgtgtcaaa
gtcttagatactcctggacctgttggtggactggacgcaactgatatcacaaagacatcc
tgccagcttgcatggttgcctccagaaaatgatggtggtagtccaatcctaaactatatt
gttgagaagcgtgaagttgacaggaaaacatggacaaattgcacaaacgatttgaagaag
acaagtttcaaaatcacaaatctgactccaggaatagagtactacttccgagtcatggca
gttaacaagtatggtattgggttacctcaagactcaccgaaatcatacttggctacagat
cctaagagtgagcctgatcctccaaagaagatggatgtattagaaattactaaaaacagc
gcaacccttgggtggttgaaaccactcagagatggtggatcaaaaattaatggctacatt
gttgaataccagcaggatggccaacctgaagacaagtggacatcatactctgttgtgaaa
gacttaacaattgttgttgctggactgaaagaaaacactaaatacaggttcagggttgca
gcaagaaatgcaataggatgcagtttggcaagagaagctgaaggcatatttgaggtcaag
gaacagctaatggctccaaagattatcgtgtctgatgtggttactgcaagagcaggatca
aaacttattgttgatgctcttgtgtctggaaaacctgcaccagtaacaaaatggaaaaga
ggaagtgatgacatagttacttctgatcgtgtcgtcatacaaaagacaccaaccacaagt
ttactcatggtcaaagatgtcacaaggaaggatagtggttattacagtttgtctgctgaa
aacagcacagctaaggtcaaccagatcatcagaataatcattatggacattcctggtccc
ccacagggtcctctacaaattcttgaggtggatgtagatgcctgcacacttgcatgggat
acacctgctgaagatggtggcagcaacattacaaactacattgttgagaagtgtgatgtg
accagaggtgattgggtcacagctgtatcttgcaccaagaccagctgcagagttgggaag
ctcacatgtggcaaggagtatgggttccgtgtccgtgctgaaaaccgttttggcatttca
gaaccaatttactcagagaaaatgattgcaagacatccatttgatccacccagtgaacca
ttgaactgttgtgttaacaaagtcagcaaggagtttgttgtgttgtcatgggagaaacct
gtaaatgatggtggcagtgccctcactggatacttcatagaacgtaaagaaagaaatagc
ctcctgtgggtcaggacaaatgaagttcttgttcggtcaactgaatacacatgctctggt
ctcattgagggtctggagtacacattcagagtgtctgctgtcaacaaggcaggacaagga
aaaccaagcaagcagacagattttatcactgcaagaagtccagttgatccacctggaaaa
ccggaaattattgatgtgaccaaaagttctgtctcccttgtctggagccgtccaaaacat
gatggtggaagcaaactcattggttattatgttgaatttctcaagcttaaagaagacaaa
tgggtgcgtgtcaactcaaacagccaaaatgtaccaaaggaagaatacattgttcctgga
cttgaggagggagcccagtacaagttcagaataattgcaaagacagcaattaatgttagt
gtgccatcagaggaatctgatgttatcccaattattgcagagcatgttccacccagagtg
gagattagtcttgaaatgaaaaacttaattgttgtcaaagctggagcaaatgtctgcctg
gaggctgaggtttatggcaaaccaatgccaaaggttgtttggaaaaaagatggtgctcca
ctgaaattggctgaaggtatgaaaatgactcaaaaggtgcatcacctctccctggaactt
ttctctgttacaagaaaggagtctggagagtacacaattactgctgagaacccaagtgga
tcaaagtctgccaacataaaattaaaggttctggacaaacctggacccccagcatcagtg
aggataagccatgtgtttgctgacagagtgaaacttaggtgggagccacctcttgcggat
ggtggttctgaaatcacaaattacatcgttgacaaacgtgaaacaagcagagcaaactgg
gcacaagttactgctaatattaatggtcagataactgactgttctgtggagaaattgatt
gaaggccatgaatatgagtttcgcatcagtgctgagaacaagtatggtgttggagaccca
attgtgactagctctgtgatggccaagaatccatttgatgtcccaggaccatgtgaacct
ccagttatcaccaatgtcaccagagatcacatgactgttacttggaaagctcctgctaat
gatggcaaagccactattcttggatacatggttgagaagcgtgaaactcaagacctcaat
tgggttaaagtgaatagaagaccagttattgacagaacaattaaagccggaggcctcact
gagggaacagagtatgaattcagagtcattgcactaaataaagctggtcttggtaaacca
agtgatccatcatctggtgttcttgctttagacccagtgtatcctcctggaccacctgct
tttccaaaggttgttgactctacacacagttcaatcagtttgtcctggaccaagcccgca
tatgacggtggatgtgaaattctgggctaccttgttgaattcaagcgagcagatgcagaa
gaatggatgaagtgcaatgtgccaaagaatctccaggcaacaaaatttaatgttactggt
ctaatagataatactgagtaccagttccgtgttagtgccgtaaacaagataggatttggt
gagccaagtgaagttcctgaaaaacatttggcaaaggatatcttacttgcccctgaggct
gaacttgatgctgatctcagaaaagcacttgttttacgtgctggagtaacaatgagaatt
tacgtgcctctaagagggcgtcctgctccaaaggcaacatggactaaggtcaatgcaaat
ttgaaagagaggcaaggtcttatgattaagacaactgaatgggataccttcctttattgt
gaggatatcaacagatatgatgctggcaaatatgttctaactttagaaaacagtagtggt
accaagtcatacaccattgttgtcaaagtactagacacacctggacctccagtcaatctg
attgttaaggagacctcaaaggaccatgtatccattacttgggatgctccattaattgat
ggtggaagtccagtgaagagctatgtggttgaaaaacgtctggctgagagaaaggcatgg
acttgtgttgctcctgagtgtcccaagacatcttttaggattactaatcttgaagctggt
caagcttactgcttcagagtccttgctgaaaatatatatggaattggggaaggttgtgag
acagctgggccagtcaaagcctcagaacaacctggaccagttgcagaatttaaatcaatg
gagatcaccaagaattcctgcactcttggctggaagaaaccaattagtgatggtggaagc
catgttgttgcatatgctttagagatctgtgaaggggaggacaaatggaagttgctaatg
aagtctaaggtcacacagtacacaattggtgatctagtagaaggaaaggagtacagcttc
agggtcaaggccattaatgaatcagctgaaggacccccgactgagctcactatcttggct
aaagatcaaatagtccctccaaactgtgaccttaaaggcttgccagattctagctatgtg
gcaaaagaggggaccactgttcgtcttaatatccctattactggaatcccagctccagca
gtcatatggaaaaagggtgatgttactttatcagacagtggaagaatctcagttgaatca
accacaacaaacacagtcttgctgattcgggattgccatagaggagatgctggcaagttt
actatcattttaagaaatagtgctggaactaaagaagcagccattgacattaaagtggtt
ggaaagcctggaatctgctctgggccaatcaaatttgatgaaatcacagccgaagcaatt
actgtagaatggggtccacccaaagatgatggtggatcagaagttaccaactactttttg
gagaaaagacattctactgctaacaagtgggtcacagttgcctctgcaattcagaagaac
tctatgagagttaccagacttcatgatggaacagaatacatcttcagagtttgtgctgaa
aataaatatggaattggagagtttctcagatctgatccagtgcttgctaaacatccattc
aatgcaccgggggctccagcaccacctgtagttgtgagcatacgtcacgagtgtgctatg
ttaacatggtctgatccaaatgatactggaggctcacccatcacaggatattacgtggaa
ttcaaagatagaaatagcttgatgtggaaaagagccagcaaaacccagttgagagtgaag
gaatgcagagtgactggcttggttgaaggccttgaatatgaatttagggtcatagctata
aatgtggctggacttggaaaaccaagccgaacaactgaatcacttgttgctcttgatcca
attgatccacctggcaaacctgatgtgatcaatgtcacaaggaacagtgtgacacttatg
tggactgcaccaaagtatgacggtggccacaaacttactggctacatggtagagaaatta
gagcaccctggaaagacatggatgaaggccaaccatgtgaatgtccaaagctgtgcctac
actgttacagatctacaggagggatgcacttgtgaattcagaatcagggctaaaaatgca
gctggagctatcagtgctccctcagagacaactgagcctcttgtttgcaaagatgaatat
gaaccaccaacaatcacaattgacccagaaatgaaggatggagtgactgtgaaagctggt
ggaacaattgtcatcacagcatctagtattctaggaaaacctcctcccactgctgtgtgg
tctaaggctggaagagaattcaagtcctcagatattgtccaaattagtagcactccgaca
tcttcaactttgtcgatcaaatatgccagccgaaagaatactggagagtacacaattaca
gcaagcaatccatttggtatcaaagacgaaaaagttaaagtgaaagttctggatgttcca
ggacctccaggtcctattgaagccagcagtgtctcagctgaaaaatgcacattgacatgg
ttgccacctgaagaagatggtggttgcagtataaaatcatatatcttagaaaagagagaa
accagccgccttctctggacaaagcttgctgaaaatgttatggattgccgctatgttgcc
agcaagctgataaagggaaatgaatacatattccgtgtttcagctgtcaatcagtatggc
actggcgatgtgacacagtctggaccagtcaaaatggttgatagctttggacccccaggg
ccgccatcaaaaccagaaattgataatgtcagcaaaaatgctgtaacaatttcctggaaa
agaccaactgtagatggaggaagtgacattagaggctatattgttgagagaaaagagaga
agaggaatgagatgggtcagagcttcaaagaagactgtttctgatctacgttttaaggtc
tcaggcttgtcagaggaaattgaatatgaattcagagtgactgcagagaataaagctggt
tttggtgaacccagtgagccatcacaacctgtaatgacaaaggatattgcatatccacca
gggcctccatcaaacccacggattactgacaccactaaaacaacagcaacatttaactgg
ggtagacccttttatgatggtggacttgatgtgacaggatacattgttgagcataaaaag
gaaggtgatgatgactgggttcaagacacaactattcccttgagaataacagaatttgtg
gtatcaaatctacagtcaggaggaaaatatcacttcagagtcagtgcgcttaattctgaa
gggcttggtgaaccatctgaagtagagcaagttgttgaactggtggatcgagaggaggtt
cctgactttgagcttgatgcagagctgagaaaaacacttgttgtgaagtcgggtgcttca
atccgtatatttgtgccaattaagggccggccagctcctgaagtagtatggtataaggaa
aatgtacctcttaaagggcgtgctcacattgatactacggaatcatacactttagtagtc
atcccggaatgtacacgatatgatgcaggtaaatatgtcttaacattagaaaatgttgct
ggaaagaagacaggatttgtcaatgtccgtgttgtggacaccccaggacctccagtaaat
ttaaaaccaagagaaatcacaaagcatagcattactctccagtgggaaattcctcttatt
gatggtggctcaaagataaaaaattatattattgagaagcgtgaggcaacgcgaaaagcc
tactcagttatcacaacaaactggcagaaatgctcatacaagattccagacttagaagag
gctgctgaatattactttagagtttcagctgaaaatgaaatgggcatcggtgaaccagca
gagacacctgatccaataagagcttcccaggctccttctgcaccagatgatcttattgtc
actgatgtttccaaggacactgcaactcttgcatggacaaaacctaaacatgatggtggt
agtcgaatcactgggtatgtaattgaggctcaactgaaagactctgatcaatgggcccat
gtgacaacaataaaagctttggactacattgcaacagaattggtggaaaatgcagaatat
gtgttccgcatatttgctgtaaatagctcaggcagaagtgaacctcgagaaagtcgacca
gttgtaataaaggagcaaaccacagctccagaatttgacctcagaagtatatatcaaaag
acagtggtagctaaagcaggtgataatcttaaagttgagatccctgttcttggtcgtcct
agaccacttgttgtatggaagaaagaagatcaggaactgaagcaaactcagaggataaac
attgaaaatactgcaagttctacaattcttaacattaatgaaattaagagaaaagatggt
ggacagtattctatgacaggaaagaatatcttaggaactgtgactgaaaacattactgtt
caagtacatgatatcccaggacctccaactggaccaattaagctggatgaagtttcttgt
gactatgttctcatatcatgggaagctcctgaaaatgatggaggagtacctattaataac
tacattgttgagatgcgtgagaccacgggtacttcctggatggaactggcagctactgtt
atccgtacaacattcaaagctgctcgtcttacaactggtatcgaatatcaattccgagtt
aaagctcaaaacagatatggtgttggtccctacataacatcaggaccagtggtggctgct
tatccatttgatgttccaggacagcctggaattccacagatagttgcctttaccaaggat
gcaatgacaatcagctggaatgaaccctcttcagatggaggaagcccaattttaggatac
cacattgagaggaaagagaagaacagcatactctggcagaggataagcaaagctgtggtt
gttggcaatatgtttaaatcatcaggtctaatggatggtatagcatatgaattccgtgtt
attgcagaaaatttggctggtctcagcaaagcaagcaagccatctgagatgacatatgca
cttgatcctgtagaccctccaagtcaaccagtagcacttaacataactagacatgaagtt
acacttcagtggacaaaaccagaaggtgatggtggtttctctataaccggatatacagtt
gaaaaaagagaactacctaatggtcgttggctcaaggccaacttcagcaacattcttgaa
acaaattttactgtgagtggtctcacagaagatgtttcttatgaattccgtgtgttagca
agaaactcagctggagctgtcagcaaaccatctaaaccttcagaagttattgtgtgcaga
gatgacattgaagaaccaaagattgatgcagatgcaagtttcagtagtgttgtggttgtg
aaagcaggagatatctttaagctagatgcacatgttacaggccgaccaataccttccata
gtttggacaaaagatggcaaggaactcgaggacactgcaaaaatggagatcaaaacatta
gatttctacagttgtttgatcaacaaagattctttgcgtagagatggtggtgcatacact
ctaactgctagcaatcctggaggatttgctaaatttgtcttcaatgttaaagttcttgac
agacctggtcctcctgagggcccattgcatgtcacagacatgacagtagagaaatgcgtt
ctgtcatggctaccaccacttcatgatggaggaggaaagattgaatattacatcattcaa
agacgtgaaacaagtagacttacatggacaaatgtagctacagatttacaagtaaaccgc
tataaagttaccaaattgctgaagggaaatgaatatatcttcagagtcatggctgtgaac
aagtatggagtgggagaacctcttgaatctgaacctgctgttgctactaatccgtatgtg
ccatctgatcctccacaggcaccagaagtaactgctatcacaaaggattcaatggtggta
tgttggggacatcctgagtacaatggtggaagtagcattaatacctacatcattgagagg
agagataaaactggtcttcgttgggtaaaatgcaacaaaaggactgttactgatctgcgc
ttcaaagtgtcaggattaacacctggacatgagtatgaatacagaatcctagctgaaaat
gctgctggcttaagtgctccaagcccttcaagtccattctacaaagcctgtgacacgata
ttccaacctggaccacctggaaaccccagggttttggatacaactaaatcatctattact
attgcttggaataaaccagtttatgatggtggctcagatattacaggctatattgttgag
acatgcctcccagaggaagatgaatggacaattgttaccccaatggcgggactgacagca
acatcattcaccataaccaaccttactgaaaaccaggaatataagataaacatttcagca
cttaactgtgaaggtgttggagagccagcttctgtgcctggttcgcctaaagcagaggac
agactccttccacctgaaattgagcttgactcagaccttcgcaaagttgtgaacatcaga
gcatgcagtaccttaagattatttgtaccagttaaaggaagacctgcgccagaaatcaga
tggtcaagggagaaaggagaaccccttgatagagcatccattgaaattacaccttctttt
accacactgctcattgaaaatgtagatagatttgatggtggaaaatatatgttaacagtg
gaaaacagttcaggaacaaaaacagcatttatcaatgtccgagttcttgacactcctggt
gcaccacaaaaccttaccatcaaagaaatcacaaaagattctgtttcactcatctgggac
cctccagtcattgatggtggatcaagaatcaggcattacattgtggaaaaacgtgaatct
acaagaaaagcatattccattgtcaatgcctcttgtcctaaaacaagttggagaattgga
gatttacaagaaggaaatttgtatttcttcagaattttggcagaaaatgagtatggtgta
ggtcttccagtagagacaatggaagctataaaaatctctgagagacctcttcctccagga
aaagttactctaaaagaagtaactagcaacagtgttacactttcttgggagaagccagac
catgatggaggaagcagaattaccggttatattgttgaaatgcaaggaaaaaacagtgac
aaatggacccaggtaatgactgttaaagtaacagaagcagttgttgttggccttacacaa
ggtgaagaatactccttccgcatttctgcaaccaatgaaaaaggaataagtgatccgcgt
ccacttagcgtccctgtcattgctaaggatgttgttattgcccctgccttcaaactgtta
tttagcacattcagtgttctggcaggtgatgatctgaaaattgacgtgccttatgttgct
cagcccaaggcagcagttgtttggcaaaaagatggcatttctttgaaggagacaacaaga
gtaaatactgaagtagcagagagacatctttaccttttattaaaggaggcaacaagggat
gatgtgggtaaatatactattaaaattacaaactcagctggtgaagcaacagcagacatc
aatgttattgtacttgataaacctggaccaccaactggcccaatcaaaatagaggaggta
actgcagacagtgttacattgtcatggcagcctccagagtatgaaggaggatgcagcatt
aataactacattgttgaaaagcgagacacatccaccacaaattggcagattgtttctgca
acagtggcaagaacaacaactaaagcggcaagactcaagactggctgtgagtatcaattt
aggattgctgcggaaaacagatatggaaagagttcagttattgtgtctgagcatgttgtg
gcgcagtatccctttgaaattccacatccacccggaattccagctgttcagtctgctact
aaagaaagcatggttgttgtatggaacaaacccagcagtgatggtggaagcaagattttg
ggatatcacattgaaagtaaagaaaaaaacagcttgctgtgggtgaaacaaaacaaaaca
atcattccagacacacgattcaagataggtggtcttgaagaaggcattgaatatgaattt
agagtgtatgctgagaatatagttggtctaagcaaagcaagcaaagtgtctgaaattcaa
gtggctagagatccatgtgatcctccaggcaaacctgaagcagttatcgtgaaaagaagc
tctgtaacactcaggtggacacccccacagtttgatggtggaatcaaaattactggatat
gttgttgaaaagaaagaactgcctaatggtcgatggatgaaagcctcttttgctaacatt
attgagactgaatttgttgtcagtgggttggtagaggagcaacaatatgagttccgtgtc
attgcaagaaatgctgcaggtgtctctagtgttccatcagacagcactggtgcaataaca
gcaaaggatgaagttgatccaccccaaattgacttggatgccaaatactctcaaaatgtt
gttgttaatgctggtgaatcattcagaattgatgcagggatacttggcaaacctattcct
tcagtgcactggataaaatctggcgaagaacttacaaatactgcaaggcttgaaatcaag
aatactgacttcacgacaactttaagtgtcaaggaggctatccgtgttgatggaggccag
tatacattattactgaaaaatgttggtggagagaaatcagtaatcatcaatgtcaaggtt
ctggacaggcctgggcctccagatggtccaatttcaatctatggagttacaagtgaaaag
tgttgcatttcctggaaaactccattgcatgatggaggtgcagaggtgtctcattacatt
gtggaaagaagagaaaccagtcgattggtttggactgttgtagaattaaaggtacaaacc
cttaatctcaaaattacaaaacttcttcctggaaatgagtatatttttagagtaatacct
gtgaacaaatatggaattggtgagcctttggaatctgatccagtgattgcagcaaatccg
tttgtcacacctgaagcaccaagtaatgttgaagtgtcaaacataacaaaggattccatg
gttatcacatgggaaagacccactaatgatggtggcagtgcaattacgggatatattgtt
gaaaaaagagacaaagaaggtgttaggtggacaaggtgcaacaaacgtgtagtgagtgaa
ctacgatttagagtaacaggacttcttgaaatgagaagttatgaattccgtgtgtctgct
gaaaacgcagctggagttggtaagccaagtccacccacagtgtacttcaaagcagcggat
ccagtctttaagcctggcccacccaacaaccctaaagtagcttatgtgtcaagagcatct
gttgtactgcattggagcaagccaatttacgatggtggctgtgagattcaaagttatatt
gttgaggcatgtgaagtcacttcagatgaatgggtgatgtgtacaccaccatcaggaata
actgaaacaagatttgaagctaaaaaactgcttgaaaagcatgagtacaaattccgaatt
tgtgctgttaataagattggcgtcggagaaactgctgatatcccaggatctgttatcatt
gaggataaacttgaggcaccagatattgatcttgatgctgacctgagaaagatgatcact
gtcagagctggaggttctcttagattgtttgttcctatccggggacgaccaactcctgaa
gtcaaatggggaaaaactgaaggtgaaatcaatgaggcagcacagattgatattacaagc
agttttacctcacttgtaattgaaaatgttaacaggtttgacagtggaaaatacactttg
accctggaaaatgctagtggaacaaaatctgcatttattagcgtcagagtattagatact
cctgatatgcctgcgaacttccgtgtgaaggaaataacaaagaactcggttactcttacc
tgggagcctcctttgctggatggtggtgctaaaataaaaagctacattgttgaaaaacga
gagagtacacgaaaggtatattctgctgttactacttgcaacaagatgacatggaaaatt
gaaccacttgaagagggaagtatctacttcttcagagttcttgctgaaaatgagcatggc
attggattgcccgcagagactccagaaccactgaaaatttcagaggtgccacaaccccct
ggcaaagtttctgtagtggatgtaacacggaagagtgtttctctaaaatgggaaaagcca
gagcatgatggaggcagcagaatcacttattatgaagttgaaatgcaagcaaaggatcaa
gataaatggtctctttgtgctcaagtaaaagcccttgatactgttgtaactaatttagca
cagggtggggagtacatcttcagagtcattgctgtcaatgacaaaggaaagagtgatccc
agacttctggcaagtcctgttgttgcaaaggacctcgctattgagcccacagtaagaaca
aaactaagtacatacagtgtacaggttggatatgatttgaaaattgaagcacgaatttct
ggtcatccaaaaccaactattacatggaacaaagatggttcagctttgaaacagaccaca
agagtaaatgttgctgacactgcacatcataccactcttaccataaaagatgcaacaaga
gaagatggtggtatgtataacattgttgtggctaatgtacttggacaacaagaagctact
gttgaaataatcatcctggaaaaacctggcccaccaacaggcccagtaagaattgatgaa
gtaagtgcagagagtattacattgtcttgggatccaccaacatacactggaggctgccag
atttcaaattatattgttcaaaagagagacacaaccaccacaaactgggtagttgtttct
gccacagtagcaagaactacactcaaagttggtaatttaaaaactggagctgaataccag
tttagaatctttgctgaaaatagatatggtaaaagctatggcattgactctgatccagtt
cttgcccagtatcctttcaaagagcccgggcctccaggaactccatttgtgtctgctttc
aataaagagtctatggttgttgaatggcacaaaccagtctcagatggtggaagtgctatt
ctcggatatcatcttgagagaaaagagaaaaatagcattctttggacaaagattaacaaa
atactcattcaagacacacgatataaaacatctccattggaagagggcattgaatatgag
tttagggtatatgctgaaaacatagttggaattggaaaatgcagcaaaacctctgagggt
tgcattgcacgtgatccctgtgacccaccaggtacccctgtgccagtcattgtgacaaga
cactcagtgaaacttagatggacaccaccagaatatgatggaggcagccttgtaactgga
tatgttgtagagaaacgagacctgccagagggccgttggatgaaagccagttttgcaaac
attcttgaaactgaatttacagtcacaggtcttatagaagactgcaaatatgatttcaga
gtaatagcaagaaatggagctggatcggtcagtagaccctctgagagcacaggctcagtt
acagctaaggatgaagttgaaccaccaacctatgaggttgcttcagagtatagtcagatt
ttgacagtgaatgctggagacacattttcccttgaagcatctgtgctgggaaagccaatt
ccagcaatgcagtggtttaagggtgacgtggaggttgaaaactcagcaagagctgagatc
aagaacactgactttaaagcagttcttgttgtcaaagatgccattcgaattgatggagga
caatacacattgcacctttccaatgtggctggatcaaaatctgtttccttcaatgtgaga
gtgcttgatagacctggacctccagaaggtccattgactgtttctggtgtgacaaatgaa
aaatgttcattgtcatggctgcctcccagacatgatggtggcagtagcatttcttattat
gttatacaaaagagagaaacaagtcgtcttgcttggactgtagtttcaggtgattgtgga
gcaaccatgttcaaagttacaaagcttctaaaaggaaatgaatatatattccgtgtcatg
gctgtcaacaaatatggagttggtgaaccacttgaatctagagcagtgattatgagaaat
ccttttgttgcacctggcccacctcaagatctagaaataacaaatatttcaagagactct
atgactgtatgctggactcgtcctgagagtgatggcggaaatgagattgttggttacatt
gtagagaaaagagacagagctggaattcgatggacaaaatgtaacaaacgcagagtcaca
gacctacgtttcagagtcacaggtttgacagaggatcatgaatatgaattcaggttatca
gcagaaaatgctgctggagttggacaaccaagtcaaccaacagtttattacaaagcctgc
gatccaacattcaagcctggccagccaactaatgcacaccttgttgacactacaaagaat
tcagtcacagttgcatggagtaggccaatatatgatggtggcttagatattcaaggctac
gttgttgagatatctaaagctgatgaagaagaatggatcacatgtactccaccaactgga
ttaaatgatactaaattttcgataactaaactcactgaacaccaagaatacaaagtccgc
atatgtgccttaaataaactaggtgttggtgagccagtgcccatccaaggcagtgtcaaa
ccagtggataaaatggatgcacctgaaattgaacttgactctgagttaaggaaaggcatt
gttgtgcatgctggaggatctatgagaatcaacataccattcaaaggacggcctattcct
gagataaactggaccaaggatgacggagatttaccagataaagcccaaatagacaaggga
ccagatttcacccatctgacaattaatatatgcgaccgaaatgatgctggaaaatataca
ttgactttgcaaaatagtgctggcaccaaatcagcatttgtctcagtaaaagtacttgac
acaccaggtgctccacagaacctttttgtaaaggatataacaagaaactatgttacactt
gtttgggaacctccacttattgatggtggttcaaaaatcaaaaattacattattgacaag
agggaatcaactagacaaggatttacaaacattactactaagtgctcgaagaccagcttc
cgtgttggtgatctgacagagggtggtatttattacttcagagtcatggcagaaaatgaa
tttggaattggcctgcctgtagaaacagaagaatctgttaagacagcagaccccccttta
tcagttggcaaggtcactttgactgatgtcacaaaaaccacagcatcactatcctgggat
aaaccagatcatgatggtggcagcagaatattgggttattacattgaaatgcagccaaaa
ggatcagaggaatggattgttgccacagtctgcaaaacatgtgagggtacagtggctgga
cttagttcaggacaagaatatctcttaagagttttagcttacaatgagaagggaaaaagt
gatcccaggccattagcttctcctgtcattgccaaagatgttactattgaaccaagcttc
aaactaactttcaacacatacagtgttcaatctggcgaagatctcaaagtggaaatacca
tttaaagggcgtccaactccaaagattggatggatgaaagatggacaagcacttaaagag
acaaccagattaaatgtctcaagcactgcaacgtcaacggttcttaaaattaaagaagca
aatagagaggactctggcaagtacacaatcacagctacaaacaatataggtacagtcaca
gaagaggttgccataatcattcttgataaaccaggtccaccaactggaccagtcaaaatc
gatgaagtaagtgccacctatgttgtcatttcctgggagccaccagtttacacaggaggt
tgtcagataaacaactatgtagtggaaaaacgtgatacaaccacgactaactggcagacc
gtttctgcaacaattgctcgaaccacaatcaaaatctcaaagctgaagactggttctgaa
tatcagtttagagtgtttgctgagaacagatatggaaagagcggatcaatagattcaacg
ccagttgtggtcagttatcctttcactgagcctgcagctcctggtgcaccatttgtttca
tcagtcacaaaagaccacatgacaattgaatggaaaccccccagcaataatggaggcagc
cctattattggatatcacctggagcgtaaagaaaagaacagcatcttatggaccaaactt
aacaaacttcttatcactgacactcgattgagaacaaatggtctggaggagggaattgaa
tatgaatatagggtttttgctgaaaatattgcaggaatcagtccatcaagcaaagtgtca
gaaagtgttgttgcacgtgacccatgtgatccacctggaactcctgaagctattgttatc
acaagaaacctcataactcttcaatggactaaaccacagtatgatggtggcagtgtaatt
acaggatacataattgaaaggaagaagttgcctgatggtcgttggatgaaggccagtttt
acaaatattatagacacacaatttacaataactggattacatgaagaacaaagatatgaa
ttcagggtaatagccagaaatgcagctggtattttaagtgttccatctgaaagtactgga
ccaattactgctcaggatgagattgaagctccatctgtctccatggattcaagatttaaa
gatgttattattgtaaaggctggtgactcctttagtattgactctgacattgctggcaaa
cctctacctgatattgtgtggcttaaggatggaaaggaaattgatagtgctacacccaga
atggagattaaatccaccattacccgaacagttttgactgttaaagactgcatcagagta
gatggtggtcattttgtcttaagtctcagtaacgttggtggaacaaagcaggtacccatt
aatgtcaaggttcttgatagacctggtccgcctgatggccctctaaaagtaactggtgtc
gctgcagaaaaatgttatttgcactggagccacccttcacatgatggtggagctagtatt
tcacattacattattgaaaaaagagaaactagcaggctgtcttggacagtagtggaacct
aaaattcaagcaatcagttacaaagttactaaactcctacctggtaatgagtatattttc
agagtaatggcagtgaacaagtatggtattggtgaaccacttgaatctgaacccgttctt
gcaaaaaatccttttaataaaccgggacccccttcaactccagaagcaagtgcaatcacc
agagactccatagtcctcacatgggaacgaccagaggatgatggtggatcacaaattgat
ggctttgttcttgaaaaacgtgataaagagggtattcgatggacaaagtgtaacaagaaa
agactaaatgacctgagattcagagccactgggcttacagagggacacttctatgaattc
agagtatctgctgaaaatgctgctggtgtgggcacaccaagtgaaccatctgaatattac
aaagcttgtgatgcaacctatcctcctggtcctcctaataatcctaaagtgacagatcat
tccagcacaactgtttctttggcatggagtagaccaatttatgatggtggagcacctgtc
tcaggatacattgttgaggcaaaggacattaacgaagatgaatggactgtgtgtacacct
ccaactggtgtccaagcaactcacttcaccgttaaaaaattaaaggaaaatgcagaatac
aacttccgtatttgtgcagttaatatagagggggctggagaacatgttgatgttccagga
tctgtaattgcagctgaaaaacttgaagctcctgaaatagaacttgatgcagatcttaga
aaatgtgttactgtgcgtgccagtgcaacacttcggttatttgtcacaataaggggtaga
ccagagcctgaggtaaagtggaaaaaggcagatggcaccttaccagagcgtgctcaaatt
gaggttacaggctcttacactgggcttgttattgacaatgttaaccggtttgacactggc
aagtatgttttaacacttgaaaacaatattggctcaaaatctgcatttgttaatgtcaaa
gttcttgactctccaagtgctccagtcaactttgaagttaaggatgtaaagagagattct
gtccagctacaatgggagcctccacaaattgatggtggagccaagataacccattacatt
gtagaaaagcgtgaatccaagagactagcattcacatctataacaaacaactgtgtcaga
aattcaatcagggttgatgatctccaagaaggaggtctttaccacttccgtgtattggct
gtcaatgaacttggtgttggtttgcctgcagagactacagaggctgtcaaaatttcccaa
gcacccttaccacctggtaaaattacagttattgatgtaactcgacacactgttactttg
tcatgggaaaagccagatcatgatggtggcagcaaaatcacaggctatatggtggaaatg
atgactaagggatcagataaatggactgcatgtgtcacaataaaggcactggaagccaca
attgaaggacttacaacaggagaggaatacagcttcagaattacagcaattaatgacaaa
ggaaagagcgatcctaaaccactgggagcacctgttgtggcaagagatattactattgaa
cccattattgatttgatgttcaatacctacagtgtaaaagctggagatgatctcaaaata
gatgttccgttcagaggcagaccttctccagaggttacatggaagaaggatggtcactcg
ctaaagcaaacaaccagagttaatgttttgacatcaaagacattatccaagatcaccatc
aaggatgctacacgagaagatgctggaaaatatgaaattactttaaccaatacatttggg
gtcaagtctgcagaaatatcggtcatcgttcttgataaaccaggcccaccaggtgcaatc
aaggtagaggaaataagcgctgattttatttcactttcatgggaccctccgatatatgat
ggtggctgtcaaattaataattatgtagttgaaaaaagagatacgactactacagcatgg
caaattgtttcagcaacagttgcaagaacatcaatcaaagtatctcgtttgacacaagga
acagaatatcagttccgtattgcagcagagaatcgttatggtaaaagccatgctattgac
tcagccccaattgtagcacaatacccctttacacctccaggccctccaaccagtcttcag
gtttctcatgccactaaatcaggaatgttagttacatggaacagaccagcaagtgatggt
gggagtcctattgttggatatcacatagagtgcaaagatcagagcagcattctttggaca
aagatgaacagaggacttataacagaaactcagttcaaagtaactggcttggaagaaggc
ctacagtatcagtatagagtatatgcagaaaatatagctggcattggaccatgcacaaag
gcatgtgatcctgtttctgcccgagatccatgtgcaccacccagtcagccacgcgttatg
aacatcacaagaacatctgtttctctttcttggacaaaaccggagtttgacggtggagct
aaggttactggctatattgttgagcgtagtgaacttccagatggacgttggttaaagtgt
aatttcaccaatcttcaagaaacatattttgatgtgactggtctgattgaagatcaaaga
tatgatttccgaatcattgctaaaaatgcagctggcttattcagtgaaccatcagaaagc
actggacctgtaacagtaaaagatgatgttgatccaccacgcataacaattgaggacaag
ctaagacaacttgttgtaataaaagctggtgaaatactgagaattgatgctgaaatatca
ggacgtccaattcctgtgatttcatgggcaaaggatggaaaagaaattgaagccaaggcc
agatttgagatttcttcaacacttactagtacaacgctaattgtgagagatgccattaga
cgtgattcaggacagtatgttctaacgttacagaatgttgcaggcaccagatctttggca
gtaaattgtaaggtcctggacaggcctggtccatcatctggaccattggatataactggt
ttgactgcagaaaaatgtacattgacctggggaccacctcaggaaaatggaggcgctgaa
attcaacactacattgttgagaaacgtgagactagccggcttgcctggactctggtctat
gcagacatgaaggccacaacatgtaaagtaacaaaattgctcaaaggtaatgagtatata
tttagagttcgaggagttaataagtatggaactggtgaagctctggagagtgatccagca
aaggcaatggatccgttcacagtccctgctgcaccaacagatgttgaagtcacaagtgtt
acaagtgaagcaatgacaatttgctgggaaagacccatctctgatggaggcagtagtatt
tctggttatgtaattgagaaacgtgagaaatctggtcttcgttgggtacgtgtgaacaaa
aagcctgtgtatgacctaagagtaaaagcttctaatctccgtgaaggctgtgagtatgaa
tacagagtatttgctgaaaatgctgctggtttgagtgcaccaagtgtgccttgcccactg
acaaaggcagaggatccattgttcctgccatcacctccagctaaacctaaaataattgat
tctactaaaacatcagtaacactgtcttggaacaagccattatttgatggtggttcacca
gtaactggatacatggtggaatacagaaataccaatgatgatgattggacagttggtgtc
aataacaccaagagcacagagttcactgttgtgggactcacatcaggaacagagtatgtc
tttgtagtcagatcaattaacaaaattggcccaagtgagccaagccctgaaactgatcca
caggtagcaaaggaaagagaagatgagccagttttcttaatcagtaatgaaatgaggaag
acactggttgtgaaagacggaagctcatttacccttagagtcccattcaaagggaagcct
gtcccacatgtaatgtggaacaaaccagatgttgatctgagagtgagggcatctattgac
acaactgatacctgcacatcggtcacaattgagcaagctacaagagatgactctgggaaa
tacactgtaactctccaaaatgttgctggaactgctacactgacgctgagtgtaaaggtc
cttgattctccaggcccaccagctcacattgaagtaaaagaagtcaccaagagttcagca
actattacatgggatactcctgacaacgaaggtggtgctccagtcaaaaactaccttgtt
gatctccgcgaggcaactaagatgggctggagcaggatttcaaacagttgtcccagattg
acttataaagtgactaatctacaagaggggggtgtatattatttcagagttactggtgag
aatgagtatggcgtaggagtgccacttgagaccaaggaaggaacaaagattacagaaaaa
ccaagcccaccacccaagcttggggtaactgatgtcacaaaagaaagtgtctcactagca
tggcttaaaccagaacatgatggaggaagcagaataacaaactacctggttgaggccctt
gaaaaaggacaacaaaagtggataaagtgtggttccaccaaatccactcatttcgttgtt
gatggtttgagagaaaatgctgaatactacttcagagttcgtgctgaaaaccatgctggg
ctaagcgaccccaaagacatggttttacctgtgcttgttaaagaccagctggaggcgcca
gaaattaatatgaaggacttccaacacaatactgcctatgttaaggcaggttcaaatctc
aagattgagatcccccttactggtaaacctttaccaaaagtttccctgtctaaagatgga
caggttctaaagtctaccatgagattcaactttgatgtgacaactgactcccttataatt
tatttgcgtgagagtgttgcttcagatgcaggcagatatgatatcacagcctctaactct
aatggaaccacaaaatcttttgtgaatgttgtggttcttgatagaccaggtccagcggtt
gggcctgttgaaatgtgtgatatcacagaggacagtgtgagtctgaagtggttgcctcct
gcatatgatggtggaagcccaatcaccaactacattgttctcaaacgtgagaccactact
gccaactggatagaagtttcatctgctgttgcaaggtgcacaatcaagatcatgaagctg
aatactggcgttgagtaccagttcagaatcaaggctgagaatcgctttggcatcagtgag
cacattgattcacaaactgtgacagtcagtcttccatacacacttcctgtggcaccttca
caaccatgggtgtcagctgtaacaaaggaaagtatcgttgtaaactggaaggagccatcc
tcagatggtggaagccatgtcttcggatatcaccttcaaatgaaagacagaaacagtatt
ctttggcagaaagttaacacaactgttattcgtgctacacactttaaagtaacaaatgtg
aatgctggtttgatctacgagttcaaggttgcagctgaaaatgctgctggtattggtcca
attagcaagtcctcagatcctgtgcttgcaatcgatgcttgtgaacctcccaacagtgtt
agagtcactgatatcacaaagaactctattagtctagcctggcagaaaccttcatatgat
ggtggaagtaaaattactggatatttaattgaaatgaaagatggtccaaaaggcagatgg
tcaaaagctaatttgacaaatgttactgacaccaagtttactgtatcaggcttgactcag
aatgaatcttatgaattccgagtcatggctaaaaatgcagttggttcagtcagtaaccca
tctgaaattgttggaccagtcacatgtgtggacacttatggtgcccctgaggttgatctt
cctcaggaatatctcgatgttgtgaaatacaaagctggtgctacggttcagcttaaaatt
ggtattgttgctaaacctcaaccaacaattgaatggtacaaggacggaaaagaacttgag
tctggagcacagatttctatttccaacaccactgagtttacatgcatttcagtcagggaa
gccactcgtctgaatactggaacatacgaactcaagatcaagaactctttaggctctgca
tatgctgcggttagagtacttgttcaagacaaacctggaccccctgctggagagatacag
tttaagaaaatcacagctgatactatgaccatcatgtgggatcctccagctgatgaaggt
ggcgcaatggtcacccactacattgtggagaaacgtgagacaagcagaattatgtggtcc
ataatctcagaaaaattacaagactgcattgtcacagtcccaaggctaattaagggcaat
gaatacatcttccgtgttcgtggcgtaaacaaacatggagttggtgatcctttggaatct
agaccagtaattgcacagaattcctttgttcatcctagtcagccttctaaacctcaagtc
accatgattacaaggtcaacaatgactgtggtgtgggaaagaccaagtttggatggtggc
agtgacattgatggatattacttagagaaacgagagaagaaaagtctacagtggttcaag
gttataaaagatccaatccgtgataccagacaaaaagtccacaacctcacagaaggaaat
gaatatcagtatcgtgtctgtgcaatcaacaaagctggtgcaggtccatattctgatgtc
tccatcttctacaaagcttatgacccaattgatccaccaagtgagcctaccaagctcaga
gttgttgattcaacaaagacatcaattactcttggatgggtgaagcctgtttatgatggt
gggagcgaaatcacaagctacgttattgaacaaagaatagctgatgagacagaatgggtc
actataagttctaaaggagaagtaagaactactgagtttgttgtgtcccatttaaaacct
ggagtttactactactaccgtgtctctgctgtgaattgtgttggaactggacgttcgatt
gagattgtgcagccagtgcaggccaaagatattctggaggaagctgatgtggatcttgac
atctcaatgtcaactcagtacatagctaaggctggtagagatgttgaaattgtaattcct
cttaagggtagacctgccccaaatgttacatggcgaaagggagacaaaaacattagtggt
gatgcaagatatgccatcagaaacacagaatactcaactacactgatcattccaaaagtc
acaagggatgacactggcaaatatcttcttgaaattgaaaatggagttggggagccaaaa
accatcacagtttctgttaaagtattggacacaccatctgcctgtaacaggttgatagtg
aagaatgtgacaagaggtaaacttactctaagctgggaaccaccttatattgatggtggc
tctccaatcacaaattacgttgttgaaaagaaggatgctaaaatgaaggcattcactatt
gtgacaaatgaatgtgccaatacaacctataaagttgatggactgtctgaagaaatttct
tatttcttccgtgtttctgctgaaaatgaatatggtgttggcgatccttgtgagactgag
cagcctgtgagagcaacagagatgcctggtgctataaaagatcttgtactggtggactca
actaatacatctgtatcactggcatggacaaagccagatcatgatggtggaagtcacatt
aatgagtacattattgagaaaaaaacaaaggatgaagaaacatggagctctggtggcaca
tgcagacgttgccagtgtgaagtaactgaacttaaagagctttctgaagtttactttaga
gtttttgcaaaaaatgagaagggtcgcagtgacttctctcaaatcgggccaatcactgta
aaggaattccttatacctcctgaggcaaaccttattgattatcctaatggagaattaagt
gttcgcattggacaaaatgtgaatattgacttaccctacaaaggtaaacccaaaccaatt
attcagtggatgaaagacgatgttatactcaaggaaagtgaacaagttcgtttcaggcaa
acagagaacaaggcaagtctcattgtaagaaatgcaagaaaggaaaatgcaggaaaatac
accttggtacttgataacaaacttgtcaagaacttctttgacatcaaagtcattacactt
gggccaccatctcagcccataggcccaatccgttttgatgaaattaaagcccagagtatt
attatctcatgggatgtaccccaagaagatggcggaggagagatcacctgctacagtgta
gaaaagcgagagacatctcaagcagcatggaagatagtttgctctagtgtggtcaggaca
acattcaagataccaaatttagttaagggtacagaataccaatttagggtgcgtgcagag
aacaaatatggagtaagtgatcctctaacctcaccagatgtggtcgctcaacaccaatat
aagccaccaggtccaccaggaaaacctgtagtattcaatgttacaagtgatggcatgact
gttcagtgggatgccccaggttttgatggtggttctccaatcactggataccaccttgag
aagaaagacaggaacagcttattgtggatgaaagtgaataccagtgttatttctggaaga
gaatacagagtcattggacttattgaaggtctggaatattcattcagagtgtatgcacaa
aacaatgctggaatgagtccagtcagtgaacagagcaaacacaaactggcaatttctcct
gttgatcctcctggcacacctaactgcattgatgttacaagagactctgtaacacttcaa
tgggaaccaccaaaacgtgatggaggcagtaggattgtagcatacagtgttgaaagacgt
caaggaagagcacgttggttgagatgcaatttcattgatgttagcgaatgtcagtttaca
gtaacaggccttgctgctggagatcgcttcgaattcagggtaattgccagaaatgctgtt
ggaacagttagtccaccatcccagtcctctggctacatcatgaccaaggatgaaagtgtc
atccctcagattgaatttgaagctgagaaatccctcaccatcaaggcaggagaaaatatt
aaactcagctgcagtataagtggacgtcctgtacctcaagttacttggtataaagatgga
aaggaagttgacaaaatgcttgttgacatcacaactgttattggatcaagctcactgttc
atcagagatgctgaccgtaaccatcgtggtatctacacagttgaggccaagaacagttcc
ggcacaacaaaagtggatgttcttgttagagtacaagatactcctggaccacccgaaggc
ccacttcgctttacaaatatttctgcagagaaagcaactctttggtggagcccacctgaa
aatgatggctgtgcagccatcagtaattatgtgattgagaagcgtgagacttccagaatt
tcatgggcacttgtaacatccaagtgtgaagcctgctccttcaatgccacaaaactgatt
aaaggaaatgaatatcagttccgtgtatccgctgtcaataaatttggagttggcaagcca
ctagagtctgatccaatcattgctcagatgcagtacactgtgccagatgcacctggaaca
cctgactgtactcatgtgacaggaaacagtattactctgtgctggacaagaccaagacat
gatggtggaaatgaaattaaacaatacatccttgaaagacgggaaaagaagagtttaaga
tgggtgaaggtttcagctaaaagaccaataactgagcttaggcacagagtaacaaacctt
acagaagggaatgaatatgaattccgtgttatggctgaaaatggtgctggaattggacct
gcaagtggtatatccagattgttcaagtgcagagagccaacaagtgcacccagtgcacca
actttggtgaaggtcattgattccaccaagacgtctgttaccctggcatggaccaaacca
gtgtttgacggtggtttggaaatcattggttacattatagagatgtgcaaggcaagcctt
gaggaatggcaccgagtcaacaatcagacgtgcatccagacacattacagagtaacagag
ttagaatcaggtgaagaatataaattccgtgtttgtgctgtcaatggtgctggcaaggga
gaattctctgagactccacatatagtacaagcagttgacagactgacctcgccagaaatt
gatatagatgcagacttcaagcaaacacatattgtaaagaatggtggaactgtcaaactt
catattcctttccgtggaaaaccagttccacttgccacatggacaaaggcagatggagat
cttggtgtaatggtggatataaatacaaccgatacattcagcaccttgacaattgaaaat
tgcactagatatgatgctggcaaatatacactctctcttgaaaacaacagtggccgtaaa
accattacactaacagtcaaagtgttggacacacctggacctccaggacctctttcattc
aaggatgtgacaaggggtgctctgacacttatgtgggatgcaccatcaaatgatggaggg
gcacgtgttcatcactacattgttgaaaagcgagaggcaagtcgattaagttggcaggag
gtcagtgaaaggtgcacacgtcaaatcctgcgagtcatcaaccttgatattggtgtggca
tacttttttagagttacagctgaaaatcaatacggcaaaggtgagccatatgaaatgaca
gagcctattatagccacagaagagcctgcatctcccaagcgactggatgtcattgataca
acatccacaacagctagcctagtgtggatgaaacctgagcatgatggcggaagccgaatt
actggatacattgttgagactagaaagaagggctctgctaactgggtttttggaggtcaa
actaaatctctgaaaatggttcttgaaggcctggttgagaacactgaatatgagttccgt
gtaaaggctcagaatgatgctggcataagtcaaccacgagatgcactagcctctgtcatt
ataaaggagccacgtatagagccaaccgcagatctgagtagtatagataaacaactcatt
acttgcaaaactggaaattcttttgccattgatattccaataagtggcagaccagccccc
aaggtaacatggaagcttgaagaaatgaaacttaaagaaacagacagagtctcgattaag
atctctaaagacagaaccactctgctggttaaggatgccaagaggggcgacagtggaaag
tattatctcacgcttgaaaatgcagctggatcaaagacattcactgttacggttattgtc
attggtagaccaaccccaccaactggacctgttgaaatttcaggagtatcatcagaatcc
tgtgtgttgacttggggagaacctagtgatgatggtggaacagacataaccaactatatt
gttgagaaacgtgagtctggctccacaacatggcaggttgtgaattcaagtgtgaaacgg
accaccatcaaagtaactcatctcaccaagtacatggagtacactttcagagtctctgct
gagaacaagtttggtgttagcaagtccattgaatctcaagctattgttgctgaacatcca
ttcatctcaccaagcccaccaactcgtcctgatgtagtttctgtgtgtgctaatgcaatt
tctattcgttgggatgtgccatatcatgatggtggaagccaagtaactggatactggatt
gaaaagaaagagcgtaataccattctttgggtgagggagaacaagattccttgtgttgag
tgccattacaaggtctccacccttattgagggtcttgagtatcagttcagagtatatgca
atgaatattgctggtttgagtaaagcaagtgaaccatcaagaccagtattggctctaaat
ccagttgatccacctggcacaccagaagtttatgatgtaaccaagacctcagtgtctatt
agatggtctgtgccatttaatgatggtggcagcaagattgttggatatgtggttgaacgc
aaggcatccagtgatgacgaagaagctcgctggttgaagtgcaactacaccacaatcaca
gaaaacttcttcactgttacatcgctcgtcgagggagagcagtatgaattccgtgttatt
gccagaaatggtgctggagttcacagtatgccatctgcatcatcaggacttataacatgc
aaagatgaatatacaccaccaaaggccgagctggacagtaaacttgtgggtgagacaatc
tccattagagctggatcagaccttgttcttgatgctgctgttggtggaaaaccagaacct
aaagtcttttgggctaagggcgacaaggagctggatcctggagagaaatactctctgaca
tacacaagcacaagagcgatggcaatcattaaatcatgtgacagaaacgatactggaaga
tacatccttactgtaaagaatgcaagtggaatcaaaacatctgctgtcaatgttaaagta
cttgatacacctggtccacctgcgggtacaataacaatcagcagggtcacagacgagaaa
tgcacagtttcctggaagattcctttagaggatggtggagatcatgtcagtcactatatt
gttgaaagacgcgagacaagcagactcaactgggtcattatggaaactgaatgcaagact
ctgtcttgtgtcagcacaaaactgatcaagaacaatgagtacattttccgtgtcagaggt
gtaaataaatatgggcctggtgtacccctggagtctgaaccagttattgcaagaaatgca
tacactgttccaacacctccgggaactccagatattactgctattggaaaagaacacgtt
attattgagtggtttaagccagagaatgatggtggaagtgaaatcaaaaactaccttgtg
gataaacgtgagaagagcagtgttagatggacaagagtaaacaaaacctacaccatttat
gatacacgcctgaaaatcactggtctccttgagggtagtgattatcagttccgcgtttca
gccgtcaatgctgctggcaccagtgctccaagtgacgcatctcagtatgctcactgtaaa
gacccaacatataccccagcaccaccatcagttcctcgtattacagataccacaaagcac
agtattagtatgacatggacccgaccaatgtatgatggtggatctgatgtcacaggctat
attgttgagattctggaggagggaacagagcagtggtatagagccacacagaagacattg
accagtactcagtacacagtaactggtctggcaagtaataaaaaatacagctttagagtg
gctgctgtcaatgctatgggtactggggaattcagtgaaggcagtatggaaactgcacct
tctgaaagagttgaaatccctgatattgagctacctgatgaacttaagaagactgtttgc
atcagagctggcaacactttacgtcttaatgtaactgtatctggaagacctgcaccagtt
ataacctggagaaagactggaattgacctacagtcccgtggtttcatagataccacagaa
aactctacatcattaatagtggagaaggtacatcgctatgatgctggaaaatacacaatt
gaggcagaaaatccctctggcaagaaaactattaccattctcgtcaagatttatgatact
cctggaccatgtggtgcagtaaatgttaaagattacactaaagagtcagttgtcatcaca
tgggatgtgcctactattgatggtggtgctcacatcaacaactacataattgagaagcgt
gaagcttcaatgaaatcttacaaaacagtgacaacagagtgcaaaaagacattatacaga
atcactggactagaagagggaacacagtacttctttagagtgttgcctgagaatatatat
ggtgtcggagaaccttgtgaaacacctgaaccagtactggtttgtgaagttccatctgtt
cctcaagatctatatctcattgatacaacaaagtctactgtcattcttggatgggaaaaa
ccacttcatgatggtggtagcagactttcaggctttgtcattgaagcttgcaaaactgga
actgatcgatggatgaatgttgcacatgtgaaatcatctgtgctgcaacacacaattgtc
tcactgactgaaaatgagcaatatctcttcagaatcagagctgaaaatagcagaggtgtc
agtgagcccagagatctcatgacacctgtaacaattcaagaacagagagaaatgccaaag
attgacttgactggtatcccacaaaagattgtcaatgtgccagctggtaagccaattgtg
ctcaacattcccattaaaggaagacctgcaccagtctgttcatggtcatttggtggagtt
aaaatgaaagacaagcttgaccgcattaagattgaaacaactgcgaaattcaccaaactg
acagtccgtgaaaccacaattgatgatactggtgactacactcttaatgtgaaaaatgtg
tccggaacagcaacggaggtcatcagagttatcattcttgataaacctggagtacctgtt
gggcctatgaaaattgaagaggttgatgccacatctgtgacatgcagctgggaaccacca
caaaaagacggaggtgcaaatgtcagtggctacattgttgagcaacgtgacgcacatcga
ccaggatggatgtctgtttctgaatcggtcacaagacccgtgttcaaatttacaagactt
gtggagggaactgaatatgtattccgtgttgcagcaacaaatcgctttggtatcggcggg
ttcttgcaatctgaggtcgttgagtgcaagagtgtcaaaactgtacctggagcacccagc
acacctgaaatacttgatgtgtctcatgatggcatgactcttacttggacaccacccgag
gataatggtggttctactattgctggctatattattgaacgcaaagaggctggatctgac
aggtggcttagcatcaataagaatccagtgactatgacaagatacagagccacaggactt
atcgagggtcttgaatatgagtatagagtgacagctataaactctagaggcactggaaaa
ccaagtgcaaattctaaaccaactattgcaatggatcctattgagcctcctggtattcca
ctaaatccgagagttacagataccacaagaacatcagtttctcttgcttggtctcctcca
gaagaggagggaggtgctgctgtaactggttatctcattgagatgcaaaaagttgaccag
gttgaatggacaaaatgcaatacaaccccaacaaagatttgtgaatacactttgacacat
atgccccaaggagctgaatacaagttccgtgttatggcttgcaatgctggtggagctggt
gagccagctgagattccaggagtggtaaaagttacagaaatgcttgaataccctgactat
gagctggaaaaaatctaccaggaaggctatgttgtcagacaaggtggcgtcatcaggcta
tcagtgcccatcaaaggcaaacccttaccaacatgcaagtggacaaaagaaggtcgtgac
atttctcacagagctatgattgcaaccagtgaagaacgtactgagcttgtaatcaaggaa
gcccatagagatgacaccggtacctacgatcttgtgttggaaaataaatgtggaaggaag
gctgtctatattaaagtaaaagttataggtcgcccagatccacctgagggtcctcttgaa
tttgatgatattcaggcacgttcagtcagagtaagctggagacccccatcagatgatggt
ggctctgatatatttggttacattgtggagaggcgtgaagtacctaaagcagcttggtac
actgtggactcacgtgtggttgatacatcacttgtggtgaagggactgaaggaaaatgtt
gaatatcacttcaagatcacagcagagaaccagttcggcattagcaaatctctcaaatct
gatgaatctgtcacaccaaagacacctctttgtccaccagaacctcctagtttccctcca
gaaattatggatgttacaaagacaacgattggtctgtcctggtcaagaccaaaggatgat
ggaggctctcgtgtcactggatactatgttgaaagaagagagatttccactgaaaagtgg
gtgcgtcataataagactcatatcacaacaacaatgtatactctcactggcctaatccca
gatgcagagtaccagttccgtgtggttgctcaaaacgatattggtcaaagtgagcctggt
cctgtgtccgagtcagttgtttgcaaagatccatttgataaaccagggcagcctggtgag
tttgatattatctctataaccaaggacagcataaccattcactggttgcgtcctgaatct
gatggtggaaaagagatccttgggtactggattgaattcaggcaagcaggtgaaagtgcc
tggaaaaagtgcaataaagaacgttcaaaggacaggcagtttaccataggtggactcatg
gaagcaacagagtatgagttcagagtgtttgctgagaatgaaactggactgagtagacca
agaagaacagcaatgggcattaaaaccaaactgagtgttggagaggctccatgcctgaag
gaggatatcaaagatactaccactaaattaggagagtctggaatattaacatgccagatt
attggaagacctcttcctgaaattaagtggtataggtatggaaaggagttgatccagagc
cgaaaatacaagatgagctctgatggccgaaaccactctttatcagtaatgacagatgaa
caagaggatgaaggcttgtatacttgtagagccgtcaatgaggcaggtgaaattgagacc
agtggaaaacttttattgcaggctgcaccacaattccatccaggattcccattgaaagaa
aaatactatgcaggctgtggaactagcctacgtcttcatgttgtttacattggtcgccct
attccacaaatcatgtggttctatggcaagaagcccctcaatccatcagagaatgttatc
attgaaaacacggaaagttacactcacttagttatcagaaatgtccagcgtaaaacaaat
gctggaagatataaggtgcaactcagcaacaaatttggcacagttgacactgtcctccgt
gttgaaatccaagataaacctctcttgcctgaaggaccagtcgttgttgatgctctattg
aagagttctgtgatcattagttggaaaccaccaaaggatgatggtggatcaatgatcaca
aattacattgtagagaaacgtgaagcgaaagagggtgagcaatggcatcttgtatcatcg
gctgtctcaggaaccacatgtcgtgttccaaacctcattgaaagctctggatattacttc
cgggtttctgcacagaatcagtacggaattagtgaatctcttgagattccatctgttgtc
attatcaagagtccattcgagaaacctggagtcccacaacggccatttgtttcatctgta
accaaggattcatgtgttgtttcttggaaaccaccaacaagtgatggaggtgccaaaatt
aagaactatttccttgaaaaaagagagaagaaacagaacaaatggattgcagttactaca
ggagaaatccatgagacatcttatactgctaaaggtcttcttgaaggatttgaatatgaa
ttccgtgtcaagtgtgaaaatattggcggagagagtgactggagtgagatttcagaacca
gtcattccaaaatcagatacagctctccgtgccccattcttcaaggatgaattgagagac
atgtgtgtaaaatacaaggcaaacgcaacctttgtcacaaaggttgtcgggcatcccaag
ccagtggttaaatggtacaaaaatggcaaagaaattttagctgatggagcgaaaataaag
gtccaagaattcaaaggaggttacttccaactagttatcagcaacgctgatgaaaatgat
gcagctgcttaccaaattagagctactaaccagcttggatcaatctcgacaagtatgaac
ctagatgttgaagttcctgccaagatttacttaccattacacctccaaggcatgggagct
gttcatgccattcgtggtgaagtggttaccatcaagattccaattagtggcaaacctgat
ccggtagtcacgtggcaaaagggacaagagattattaacaacacagcttaccatcaggtt
attatcacaaggtcattcacctccctggtgttcctaaagggagtacaaaggaaggattct
ggctactacattatttgtgccaaaaatcgctttggcatggataagcagacagttgaactc
gatgttgcagatgtgcctgatccaccaaaagatgttaaagtcagtgatattggcagagat
acactcactctcacttggagtcctggcaatgatggtggaagtgaaattattaattacatt
attgaaaagtgtcctaccactggagaccgatggattcgtgttgcacagacatctgaatcc
caatataccgtcatgagtctctttggcaaaacaaagtaccagtttagagtgattgcagaa
aacaggtttggggtgagtgatccatctgcaccaactgaccctgtgactaccaaagaagac
aagttagcaattcgaaactatgatgaagaagtggacgaaacaagagaagttacaaaggaa
gaggcaccacattcaaaagtcaaacacgtaccatcactgtacacagtttctgaggaactt
gcacgtaatggacagtttggcattgtccatcgcagtattgaaattagctctaagaaaaca
ttcttggcaaaattcatcaaagttaaaggtgctgatcgagagctggttgcaagagaaatt
gagacactcaatattgcaagacataaaaactttctgtatcttcatgaatcctttgatagc
ttggaagaatacgttcttatttatgaattcctttctggtatggacatctttgagcgtctt
ggtataaactttgacctcactgagcaagaaattgttcagtatctgagacaagtctgtgga
gccctgaagttcttgcatagcaaaaactattgtcattttgatatcagacctgacaacatt
atttattccacaaggaaaagcaatacaatcaagatcattgaaatgggccaggctcggttg
cttacacctggagaaaacattaggattcagtttactgccccagagtactatgcacctgaa
atccacaccagtgattttgtaacaactgccactgacatgtggtctgtaggtgttcttgct
tacgtcctcttaagtggacttaatccgtttgcttctgaatcaaaccagaaaatgattgag
cacatttcaaatgcagagtatatgtttgatagtgaagcctttaaagagaccagccttgag
gctatggactttgttgacagactgttaactaaagactccaagctacgtatgactgcctca
gaagctttggagcacccttggctcaggatgaaattggaacatgttagttcaaaagtcatc
aagactttgagacacaaaagatactaccagtcacttgtgaaaaaggaatggagcactgtt
gtttcatcagcacgtgttgcctatggtggtggctacagaaaccagaaaaatgtttccatt
ggaagagtgaaaattggacatcctcaacaaggcttgagagcaggacctatcatgcatgga
tctgctgaagagggaggacatgtcaggtttgtgtgctgcattgaaaactatgatcgaaac
actgaagtgacctggtactttggttcccgcaaattaactgcaagccacaaatatgaaatt
acatatgctaatggtgttgctagcatctatgttaaagacattgaagaatgtgatgatgga
ttatatagatgcaaggttgtcagtgaagacagggaggacaatgcatatgctgagttattt
gttgagactgtcaggtccttccgtgagtactaccttggacgctcgctgaagaaacccagg
cgtagaattgacaaaagcaaaattttgcagaggccaccagagtttactttgcctttattc
aatcgttcagcatacattggtgaagatgtgcgctttggtgtgaccataactgtccatcca
gagccaagtgttacatggttaaaggctgggcacagaatcaagccagatcctaaaaaatac
acattcacaagtgacaagggtctttatcagctcatgatacacaatgttgacctcagtgat
gatgctgaatacactgttgtagcaaacaacaagtttggcgaagacagttgcaaagcccgt
ctcaatgtagcaccacatgctgttgctgaggatactatgagaccaatgtttaaacgtctc
ttagccaatattgattgtgttgaggggcagagcgtccgctttgacttgagagtatcagga
accccagcaccaactttgaaatgggagaaaaatggcaaacctcttgagttcagaccacaa
gttgaagttgttcaagaggatgtagactatttcattctacatattagagaaactctcata
gaggattcaggaacatacagagtcactgcaacaaatacagctggatcagcaagctgtcaa
gctactctcaaagttgaacgactaacatacacaaggagggagttcaagagcgaggaagaa
agacatatatatgtaagaaaccaaatagaaaagacactgaaaatggcacaagagttctca
aaagctgaagttgttgcactcaatcctgtagcacaagaggctttgaaagaagctgcggaa
ttatataaaccggcagttagcaccaagcatgtgcagggtgagtttgatatctctgataaa
gaggatcaagaaataaagaaaattatagaggaagagaagaagatacgtatgccttatgaa
atccctgaagcccgtgcacatgatccaacagttcttgatgaagataaaatgattaaacac
tttgtgcccctatctgacatgaaatggtataaaaagttgcgtgaccagtatgaaattcct
gagagaatggaaagaatagttcagaagagacaaaggcggattcgtctttccagatgggag
caattttatgttatgccactgcctagaataactgatcagtacagaccgaaatggcgcatt
ccaaaacttacacaagatgatttggagactgttcgaccagccaggcgttcaccatcccct
gaatcagaggcatcattcagactgagaagacgctcacttggtgatatttcagatgaggag
ctgcttaaggaagaggagtatctggcaacaaaattatcagaaaaagaaagacgagagctt
gaagaagaactagaactgggcttctctgcctccccacctagtggaagccctgtgcgcttt
gagttgtctgcactgcgacgtgcctcaccaagacctgttcacagagctgaagtgagacgt
gtagaagagacaaaacatgtaacaacggagcaagctcgaggctctcctcctcctatatca
catttcttgagaaggagaagatccttgtctccaacatacattgaactgatgcgccctgtc
tctgaactcatcaggcaacctcgtgcacgcatcccaacagaggctgaagttgaaataatt
gaaagaagatcacccacccctgagagaactcgtcctcgatcaccaagtcctgtatcccca
gaaagaagatcctccagatcctcttctagatttgaaaggtctgcaagatttgacatcatg
tctagatatgaagcaaggaaagctgctcttaaatctgagcgcaaataccaggttgtaaca
cagcaaccattcagtcttgaccatgctccacgtatcactgtaagaatgcgctctcaccgt
gtaccatgtggtcaaaacactaaattcactttgaatgttcagtccaagcctgatgccaat
atccagtggttccacaatggacaacaaatacaagagagccacaaataccagtttacaaat
atgagtggagtcctatctctccagattaatgactgtcaggctgaggacactggcacatac
cgtgctctttgcacaaattcaaagggtgaggcatcagactatgcaactcttgatgtttca
ggtggagcatttactacatactcttcaagacgtcgagatgaggaggccccgacacaaatt
gtacctgatataacaaaaacagattattatcattcaacaacaatcagagcttcctctgcc
tcaagaactcacttggagattcaagaattcaaaacaaagttaaccgagagacatgaagtt
tcttcctttgaaaagtatgaatctcagaggcttgcatcatctccaattagatatgcatca
actgaatacctatcatcagcttcatattcatcctctgagagacatacaacatcagaaaag
catgtgtcatctgaatcaaagttaaaagaatcagaaacatctgctgaagtatcggtaaag
aaaattaaagctaccctttcagccaaaatactcacaaaaccacattctctgattgtgtct
gagggtgactctgcacgattcgtgtgtgatattgatggagagccagcaccaactgtcaca
tggatgcatgagggaagaacagttgtctcttcacatcgtattcatgtgtctaccacacag
tataagtctactttggaaatttcatcagttgaatattcagatgagggcaactatactgta
gttgtggaaaattcagaaggaaagcaagaggcaagatgtaccttggctattaataaacca
atacttaaagaggaagtaacaccaacacaagtgaagtcaccagagccctcagtggcatct
ccggtgccaccaattaaatctccagagtcatcagttacttctccagtgccatctgtaaag
tccccagagccctctgtgaaatctccagtgccatcggtaaagtctccagaacctttggta
aaatcccctgtaccatcactgaaatctccagagccttcagtcaaatcccctgtgccttcc
gtaaagtctccagaaccccaaattaaatcaccagaacccactggcattaagtctcctgaa
cctcgaattaaatctccagagggcatcaagtcaccattcagagtaaaatcaccagagcca
gccacctctcttcagagagttaaatctccacctcctcttaaatctccagaaccaaccaca
cctcaaggagtgaagtctccaatagcttcacctcccagggtaaaatctcctcctcctatt
aagtctcctgagccaattgcttcgcctctgagagtaaaatcccctacaggacttaagtct
cctgaacctcaaagagccaaatccccaccaacagtcaaatctcctgaaccaattatgtca
cctaaaagaatgaaatcaccacttacagtgaagtccccaaccccatcaaaggaagcacca
ccaaagatcattcagcaactcaaagctgaggcttttgaagacaaaattaggatgatcttt
gttgctgagagctcactgagagaagttgtgtggtacaaagacagcagaaaactaagccaa
agcagtcactaccagattcattcatctgcagatggaacttgctgtctctatatatccgat
gtttcagaggacgatcaaggtgaatattcatgtgaaatcataagtgagggaggagcagtg
tcaagaacatcattctcttttgttgggcaagtgtttcaagcaatttacacaaaagttact
gcattcgtcgctgcacataaggctgttcaagaatccgtgtcttccaaaatccaaggagga
agtgaaatggttattaagagggaaagtgctgcagttagcagcatgcatgaaagttttacc
tcaaaatccatccacatggagagcacaatgcaagaggcatcattcagcagttcagcaatg
gctgagatgaaatttgaaactatgtcaatgtctagcatgtcatccatgacatcagagtca
gtgtatgcaatgagctcaagcagtataatgtcaagtcattcacatgctgaagaaacttca
gtcagagcagcccttcacagtgctcaaggcttagctccgagaattgaagctcttcctgaa
gatatcagcgttgaaactggaaaggttcttaccgtggcttgtgccttctccggagaacca
gcacctcatattgagtggtctcgaggtggaaagaaactgcctggagaagaagatagcagt
aggttccatattgagacaaccgaggacctcaccacactcattatcactggtgtgaaagag
accgatgctggggcatacacactcaaactttctaatgagcatggatctgacttggcaact
gttaccatcagtattcgatcaaagtaa

DBGET integrated database retrieval system