KEGG   Danio rerio (zebrafish): 321051
Entry
321051            CDS       T01004                                 

Gene name
ap2m1a
Definition
(RefSeq) AP-2 complex subunit mu-A isoform 2
  KO
K11826  AP-2 complex subunit mu-1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    321051 (ap2m1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    321051 (ap2m1a)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    321051 (ap2m1a)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s muHD
Other DBs
NCBI-GeneID: 321051
NCBI-ProteinID: NP_997742
ZFIN: ZDB-GENE-030131-9784
Ensembl: ENSDARG00000002790
Vega: OTTDARG00000021416
UniProt: Q6NWK2
Position
2
AA seq 436 aa
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMTAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKGQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLES
VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIDKQGKGGTTDDAGKSGKQ
SIAIDDCTFHQCVRLSKFDSERSISFIPPDGEYELMRYRTTKDIILPFRVIPLVREVGRT
KLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMA
GMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFESKLNYSDHDVI
KWVRYIGRSGIYETRC
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgattggaggactgttcatctacaaccataaaggggaggtgctgatctcccgtgtctac
cgcgatgatatagggcgaaacgcagtggatgcgttccgtgtgaacgtgatccatgcccgt
cagcaggtgcgctctccggtcaccaacattgcccgcaccagcttcttccacgtcaagcgc
tccaacatctggctggctgccgtcaccaagcagaatgtcaacgctgctatggtgttcgag
ttcctctacaagatgtgcgacgtcatgacggcctactttgggaagatcagcgaggaaaat
atcaagaataactttgtacttatctacgagttgctggatgagattctggactttggatac
ccgcagaactcggagacaggagcgctgaagacctttattacccagcagggcattaaaggc
cagcatcagactaaggaggaacagtctcagatcaccagccaggtgacgggtcaaatcggt
tggcgtcgtgaaggcatcaagtaccgccgcaatgagctcttcctggatgtgctggagagt
gtcaacttgcttatgtctccccagggtcaggtcctgagtgctcacgtctctggtcgtgtg
gtgatgaaaagctatctgagcggaatgcctgaatgcaaatttggaatgaatgacaaaatc
gtcatcgacaagcagggcaaaggaggaaccactgatgatgctgggaaaagtgggaaacag
tccatagccatcgacgactgcactttccatcagtgtgtgcgtcttagcaagttcgactcg
gagcgcagcatcagtttcatccctcctgatggcgaatatgagctcatgaggtaccgcacc
actaaggacataattctgcccttccgggtcattccactggttcgagaggttggacgcaca
aagctggaggtcaaagttgtcatcaaatctaacttcaaaccctcactcctggcacagaaa
atagaggtgcgcattccaacacctctgaacactagtggagttcaggtgatctgcatgaaa
ggaaaagccaaatacaaggccagcgagaacgccatcgtgtggaagatcaaacgtatggca
ggaatgaaggaatctcagatcagtgctgagatcgagctgctgcccactaatgataagaag
aagtgggcccgtccacccatttccatgaactttgaggttccctttgctccttcggggttg
aaggtgcgttacctgaaggtgtttgagtccaaactgaactacagcgaccatgatgtgatt
aaatgggtgcgatacatcggacgcagcggaatctacgagacgcgctgctaa

DBGET integrated database retrieval system