KEGG   Danio rerio (zebrafish): 321541
Entry
321541            CDS       T01004                                 

Gene name
slc20a1b
Definition
(RefSeq) sodium-dependent phosphate transporter 1-B
  KO
K14640  solute carrier family 20 (sodium-dependent phosphate transporter)
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    321541 (slc20a1b)
Transporters [BR:dre02000]
 Solute carrier family (SLC)
  SLC20: Type III Na+-phosphate cotransporter
   321541 (slc20a1b)
SSDB
Motif
Pfam: PHO4
Other DBs
NCBI-GeneID: 321541
NCBI-ProteinID: NP_997753
ZFIN: ZDB-GENE-030131-260
Ensembl: ENSDARG00000010641
Vega: OTTDARG00000019659
UniProt: Q6PFM1
Position
10
AA seq 665 aa
MVSTTLATITIMSTLVGYTTGPLTDYMWLLIVGFIIAFVLAFSVGANDVANSFGTAVGSG
VVTLRQACILASIFETLGSVLLGAKVSETIRKGIIDVTMYKDIEHVLMAGSVSAMFGSAV
WQLAASFLKLPISGTHCIVGATIGFSLVAKGQQGVKWLELLRIVASWFLSPLLSGVMSAV
LFYFVRMFILQKKDPVPNGLRALPFFYAVTMGINLFSIMFTGAPMLGFDKLPWWGVLLIS
IGFGIITALIVWFAVCPRLKKKIECEVKSSSPSESPLMEKRELHEAHSPILKPVPEESSV
LSSSTPTTPPLPPPEERRVTFDIGDSDDADQKDCKESDLGGAPKTAHVHFTNGPAHIPSN
GYSQYHTVHKDSGLYKDLLHKLHLAKVGDCMGEGGDRPIRRNNSYTSYTMAIIGMHGDFK
PKESEFRASEDGDKEKAGAQERKRIRMDSYTSYCNAVAENGTPEDLGEGEVTLEMVDEDA
GSSRSSLEEDRTDADKPEVSMLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYESG
SVISSAPTPIWLLLYGGVGICVGLWVWGRRVIQTMGRDLTPITPSSGFSIELASAVTVVV
ASNIGLPVSTTHCKVGSVVAVGWLRSRKAVDWRLFRNIFMAWFVTVPISGLISAAIMALF
NYVIL
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggtgtcaacaactcttgccacgataacaattatgagcaccctcgtcgggtatactaca
gggcctctgacagactatatgtggctcctgatcgtaggcttcatcatagcatttgtcttg
gccttttcagtgggcgctaatgacgttgccaactcattcggtacggcagtaggctcaggt
gtagtaacccttaggcaggcctgtattcttgcttctatctttgagactctgggctctgtg
ctgcttggagccaaggtcagcgagaccatccgcaaaggcattatcgacgtgaccatgtac
aaagacattgaacatgtgttgatggctggctcggtcagcgctatgtttggctctgctgta
tggcagttggctgcttcttttctgaaactacctatttctgggacccactgcatcgttgga
gctactataggcttctcgctggttgctaaaggtcagcagggagtcaaatggctggagctt
ctcagaattgttgcttcatggttcctctcgcctttgctgtccggcgtaatgtctgccgtc
cttttctactttgttcgcatgttcatcttgcaaaagaaggatccagtgcccaatggtctg
agggccctgccatttttctacgctgttacaatgggcatcaacctgttttccatcatgttt
accggagcaccgatgctgggctttgataagctgccctggtggggagtgctactcatttcc
atcggctttggcatcatcaccgccctcatcgtttggtttgctgtttgcccacgactcaag
aagaagatcgaatgtgaagttaagtcttccagtccctctgagagtcctttaatggagaag
agggagctgcacgaagctcacagtcccatcctgaaacctgtccctgaggaatccagtgtc
ctgtcctccagcacccccacaactcctcctcttcctcctcctgaggagcgcagggtcacc
tttgacattggcgattcagatgacgctgatcaaaaggactgcaaggagtcagacctgggc
ggtgctccaaagacagctcatgttcatttcaccaacggccccgctcacattcccagcaac
ggatactctcaataccacacggttcacaaggactccggcctctacaaggacctgctgcac
aaactccatctggcaaaagtgggagactgcatgggggaaggtggcgaccggcccattcgt
cgcaacaacagctacacctcctacaccatggctataatcggcatgcacggagacttcaag
cccaaagagtctgaattccgcgcttcagaagatggagacaaggaaaaggccggcgcccag
gagaggaagcgcatccgaatggacagctacaccagttactgtaacgcagtggcagagaat
ggtacccctgaagacctcggcgagggggaggtcactttagagatggttgatgaagatgcc
gggagcagccgtagttcattagaggaggacagaaccgatgctgataaacctgaggtgtcc
atgctctttcagttcctgcaaattctcaccgcctgtttcggctcgtttgctcacggagga
aatgatgtcagtaatgcaattggtcccctggttgctctctggctggtctatgagagtggg
tctgttatatcgagtgcaccgactccaatctggctgctgctgtatggaggagtgggcatc
tgtgtgggcctgtgggtctggggccgtagagtcatccagaccatgggcagggacctgacc
cccatcaccccatcaagcggtttcagcatcgagctcgcctccgctgtcactgttgtggtg
gcttccaacatcggtcttccagtttccactactcactgcaaggtcgggtctgtggtggct
gtggggtggctgcgctccaggaaagctgtggactggcggctgttcagaaacatcttcatg
gcctggtttgtcacggtgcccatttctggccttatcagcgccgccatcatggcccttttc
aactacgtcattctgtga

DBGET integrated database retrieval system