KEGG   Danio rerio (zebrafish): 321556
Entry
321556            CDS       T01004                                 

Gene name
hnrnph1l
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein H1, like
  KO
K12898  heterogeneous nuclear ribonucleoprotein F/H
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dre03041]
    321556 (hnrnph1l)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    321556 (hnrnph1l)
SSDB
Motif
Pfam: RRM_1 zf-RNPHF Helicase_C_2
Other DBs
NCBI-GeneID: 321556
NCBI-ProteinID: NP_997754
ZFIN: ZDB-GENE-030131-275
Ensembl: ENSDARG00000005551
Vega: OTTDARG00000022688
UniProt: F1QFJ8
Position
21
AA seq 407 aa
MADDEGFVVRVRGLPWSCSAEEVSRFFSGCKISSNGSAIHFTYTREGRPSGEAFVELESE
DDLKIAVKKDRESMGHRYVEVFKSNNVEMDWVLKHTGPNCPETEGDGLVRLRGLPFGCSK
EEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQDIAEKALKKHKERIGHRYIEIF
KSSRAEVRTHYEPPRKGMGMQRPGPYDRPSGGGRGYNGMSRGGSFDRMRRGGYGGGVSDG
RYGDGGNFQSTTGHCVHMRGLPYRATEPDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEF
ATHEDAVAAMSKDKANMQHRYVELFLNSTAGGSNGGYGGQMMGGMGNQSSYGHGGQQMGG
GYTGGYSSQSSMGGYNDYNSQGGMSNSYYGGSRGSVGMNGMGGGWGM
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggccgacgatgaaggatttgtcgttcgtgttcggggtctgccttggtcttgctctgca
gaagaagtatccaggtttttttcaggctgtaaaatttccagcaatggatcagccatccac
ttcacatacacacgagaaggcagaccgagtggtgaagcttttgtggagctggagtcagag
gacgacctgaagatcgcggtcaagaaagacagggagtcaatgggccatagatatgtagaa
gttttcaaatcaaacaatgtggaaatggactgggttttgaagcacactggtccgaactgt
ccagagactgagggagatggactggtcagactgcgcggccttccttttggatgtagcaag
gaagagattgtgcagtttttttcagggttggaaatcgtgccaaatgggataacattgccg
gtggacttccaggggaggagtacgggggaggccttcgtgcagtttgcttcacaggatata
gctgaaaaggctctaaagaaacacaaggaaagaatagggcacaggtatattgagatcttt
aagagcagcagagctgaagtacggacccattatgagcctccgcgtaaaggcatgggcatg
cagagacctgggccttatgaccggcccagcggaggaggacggggctacaatggcatgagt
cgtgggggatccttcgaccggatgcgccgtggaggatatggtggaggagtgtcagatggg
cgttacggtgatggtggtaatttccagagtaccacaggccattgtgttcatatgagggga
ctcccttaccgggccacagaacccgatatctacaattttttctcacctctaaacccggtc
cgtgtgcacattgagatcggtccagatggacgggtgaccggtgaggctgacgttgagttt
gcaacacatgaagatgcagtggctgcaatgtcaaaggacaaggccaacatgcaacaccga
tatgttgagttgttcctaaactcaacagcagggggcagtaatgggggctatggagggcag
atgatgggaggaatgggaaatcagtcatcttatgggcacggaggacaacagatgggtgga
ggatacactggaggatacagcagccagtccagcatgggaggctacaatgactacaatagc
cagggtgggatgagcaacagctattacggtggcagccgtggctcggtgggcatgaatggc
atgggaggtggctggggcatgtag

DBGET integrated database retrieval system