KEGG   Danio rerio (zebrafish): 321622
Entry
321622            CDS       T01004                                 

Gene name
hmgb1a
Definition
(RefSeq) high mobility group protein B1a
  KO
K10802  high mobility group protein B1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03410  Base excision repair
dre04140  Autophagy - animal
dre04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    321622 (hmgb1a)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    321622 (hmgb1a)
  09143 Cell growth and death
   04217 Necroptosis
    321622 (hmgb1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    321622 (hmgb1a)
   03400 DNA repair and recombination proteins [BR:dre03400]
    321622 (hmgb1a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    321622 (hmgb1a)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    321622 (hmgb1a)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     321622 (hmgb1a)
   MMR (mismatch excision repair)
    Other MMR factors
     321622 (hmgb1a)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   321622 (hmgb1a)
SSDB
Motif
Pfam: HMG_box_2 HMG_box HMG_box_5 NOA36
Other DBs
NCBI-GeneID: 321622
NCBI-ProteinID: NP_955849
ZFIN: ZDB-GENE-030131-341
Ensembl: ENSDARG00000099175
UniProt: Q6NX86
Position
10
AA seq 205 aa
MGKDPTKPRGKMSSYAYFVQTCREEHKKKHPEATVNFSEFSKKCSERWKTMSAKEKGKFE
DMAKLDKARYEREMKNYIPPKGEKKKRFKDPNAPKRPPSAFFIFCSEFRPKVKEETPGLS
IGDVAKRLGEMWNKISSEEKQPYEKKAAKLKEKYEKDIAAYRSKGKVGGGAAKAPSKPDK
ANDEDEDDDEEEDEDDDDEEEEDDE
NT seq 618 nt   +upstreamnt  +downstreamnt
atggggaaggatccgacaaaaccaaggggcaaaatgtcctcttatgcatactttgtccag
acttgccgagaggagcacaagaagaaacaccccgaggcgacggtcaacttttctgagttt
tccaaaaagtgctcagagcgatggaagactatgtcagccaaagaaaaagggaagtttgaa
gacatggccaaactggacaaggcacgttacgagagggagatgaagaactacattccaccc
aaaggcgagaagaagaagaggtttaaggaccctaatgctcccaagagacccccgtctgcc
ttcttcattttctgctccgagttccgacccaaggtgaaagaagagaccccgggtctgtct
atcggagacgtggccaagagactgggtgagatgtggaacaaaatatcatctgaagagaag
cagccgtacgagaagaaggccgccaagctgaaggagaagtacgagaaggacatcgctgcc
tatcgctctaaaggcaaagtgggaggaggcgcagccaaagccccatccaagccagacaag
gctaacgatgaggacgaagacgacgacgaagaggaggacgaagatgacgatgatgaagag
gaggaggatgacgagtag

DBGET integrated database retrieval system