KEGG   Danio rerio (zebrafish): 321724
Entry
321724            CDS       T01004                                 

Gene name
atp6v0b
Definition
(RefSeq) V-type proton ATPase 21 kDa proteolipid subunit
  KO
K03661  V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00190  Oxidative phosphorylation
dre01100  Metabolic pathways
dre04142  Lysosome
dre04145  Phagosome
Module
dre_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    321724 (atp6v0b)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    321724 (atp6v0b)
   04142 Lysosome
    321724 (atp6v0b)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-GeneID: 321724
NCBI-ProteinID: NP_955855
ZFIN: ZDB-GENE-030131-443
Ensembl: ENSDARG00000031681
Vega: OTTDARG00000019873
UniProt: F1QYM3
Position
2
AA seq 206 aa
MMNGHAILYTGVTLAFWSTMVIVGICYTIFDLGFRFDVAWFLTETSPFMWANLGIGLAIS
LSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNLAENFS
GTTPETIGSKNYQAGYSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNANLFVRILIV
EIFGSAIGLFGVIVAILQTSKVKMGN
NT seq 621 nt   +upstreamnt  +downstreamnt
atgatgaacgggcacgcgattttatacaccggggtcactttggccttctggtcgactatg
gtgatcgtcggtatttgctatacaatttttgaccttggatttcgatttgatgtagcatgg
tttttaacggagacttctccatttatgtgggctaatcttggaattggcctggccatttct
ctgtctgttgttggagctgcatgggggatttacatcactgggtccagcatcattggtggt
ggagtcaaagctccaagaatcaagaccaaaaatcttgtcagtattatcttttgtgaagct
gttgccatttatgggatcatcatggcaattgtcattagcaatttggcagagaacttcagt
ggcacgactccagagactattgggtcaaagaactaccaagcgggctactccatgttcggt
gctggactcacggttggcttttcaaacctcttctgtggcatctgtgttggcattgtgggc
agtggtgctgccctggcggatgctcagaatgccaacctctttgtcaggatccttattgtt
gaaattttcggcagtgccattggactgtttggagtgattgtagccattttgcagacatcg
aaagtaaaaatgggaaattag

DBGET integrated database retrieval system