KEGG   Danio rerio (zebrafish): 322265
Entry
322265            CDS       T01004                                 

Gene name
psmd11b
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 11B
  KO
K03036  26S proteasome regulatory subunit N6
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03050  Proteasome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    322265 (psmd11b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dre03051]
    322265 (psmd11b)
Proteasome [BR:dre03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     322265 (psmd11b)
SSDB
Motif
Pfam: RPN6_N PCI RPN6_C_helix DDRGK AAA_16 TPR_12
Other DBs
NCBI-GeneID: 322265
NCBI-ProteinID: NP_955886
ZFIN: ZDB-GENE-030131-984
Ensembl: ENSDARG00000005134
Vega: OTTDARG00000027381
UniProt: F1QGH9
Position
12
AA seq 422 aa
MAAAAVVEFQRAQSLISTDRNASIDIFHSIVRRDVQEDDEEAVRVKEQSILELGSLLAKT
GQAAELGGLLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKAE
KRTFLRQALEARLISLYFDTKRYQEALQLESQLLQELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQAALDMQSGITHAAEEKDWKTAYSYFFEAFEGYD
SIDSPRAVTALKYMLLCKIMLSLPEEVQALISGKLGLRYAGRQTDALKCIAQASKNRSLA
DFEKALTEYTKELRDDPIINTHLAKLYDNLLEQNLIRVIEPFSRVQITHIAGLIKLSKND
VERKLSQMILDKKFHGILDQGEDVLIIFEEPPVDKTYEAALETIQNMSKVVDSLYNKAKK
LT
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcagccgcggcagtggtggagtttcagagagctcagtctctcatcagcacagacaga
aacgcttctattgacatttttcattcgatagtgagacgagatgtccaggaagatgatgaa
gaggcggtgcgtgtcaaggagcagagtatcctggagctgggcagtctcttggccaagacg
ggacaagctgcagagcttggaggtctgctgaagtttgtgagacccttcttgatctcgata
agtaaggccaaggcagcacggttggttcgttcactgctggatctatttctggacatggaa
gccgccacgggccaggaggtcgagctgtgtctggaatgcatcgaatgggctaaagcagag
aagagaaccttcctcagacaggccctggaggctcggctcatttcactctattttgacacc
aagagatatcaggaagcccttcagctagagtctcagctgctgcaggagctgaagaagatg
gatgataaagctctgctggtggaagtccagctgctggagagtaaaacctaccatgctctc
agtaaccttcccaaagccagggctgccctcacctcagccaggaccaccgccaatgccatt
tactgtcccccaaagctccaggcagctcttgatatgcagtcaggtatcacccatgcagct
gaggagaaagattggaaaactgcctattcttacttctttgaggcttttgagggctacgac
tccatcgatagccccagggccgtcactgcactgaaatacatgctgctctgtaagatcatg
ctcagcttaccagaagaggtacaggctttgatcagcggcaaacttggtctgcgatatgca
gggagacagactgatgcactgaaatgtatagcacaagccagcaagaacagatcattagca
gattttgaaaaggccctgacagagtacactaaagagctgagggacgaccccatcattaac
acacatttggccaagctttacgacaatttgctggaacagaacctcattcgggtcattgag
cccttttccagagtacagataacacatatagcaggtctcatcaagctctcaaagaatgat
gttgagaggaaactgtcacaaatgatcctagacaaaaagtttcatggcatcctcgaccaa
ggtgaagacgtgctcatcatattcgaggagccccctgtggacaaaacttacgaggcagct
ctagaaaccatacagaacatgagcaaagttgtggattcactgtacaacaaggctaagaag
ttaacataa

DBGET integrated database retrieval system