KEGG   Danio rerio (zebrafish): 322339
Entry
322339            CDS       T01004                                 

Gene name
cs
Definition
(RefSeq) citrate synthase, mitochondrial precursor
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00020  Citrate cycle (TCA cycle)
dre00630  Glyoxylate and dicarboxylate metabolism
dre01100  Metabolic pathways
dre01200  Carbon metabolism
dre01210  2-Oxocarboxylic acid metabolism
dre01230  Biosynthesis of amino acids
Module
dre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dre_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    322339 (cs)
   00630 Glyoxylate and dicarboxylate metabolism
    322339 (cs)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     322339 (cs)
SSDB
Motif
Pfam: Citrate_synt PAS_3
Other DBs
NCBI-GeneID: 322339
NCBI-ProteinID: NP_955892
ZFIN: ZDB-GENE-030131-1058
Ensembl: ENSDARG00000103364
Vega: OTTDARG00000021278
UniProt: Q7ZVY5 B2GT34
Position
23
AA seq 468 aa
MSFLSISRLAPRLLSSKNAACVVVAARNASASTNLKDVLSDLVPKEQSRIKNFKQQYGKT
SIGQITVDMVYGGMRGVKGLVYETSVLDPDEGIRFRGYSIPECQQLLPKAPGGEEPLPEG
LFWLLVTGQVPTEEQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQFSAAITALNSE
SSFARAYSEGVNKAKYWEFVYEDSMDLIAKLPCVAAKIYRNLYREGSSIGAIDSNLDWSH
NFTNMLGYTEPQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFSAAMNGLAG
PLHGLANQEVLVWLTALQKELGGEVSDEKMRDYIWNTLKSGRVVPGYGHAVLRKTDPRYT
CQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMN
YYTVLFGVSRALGVLAQLVWSRALGFPLERPKSMSTDGLMALVGAKSG
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgtccttcctctctatcagcagactagccccaaggctcctcagttcaaagaatgcagca
tgtgttgttgtggctgccagaaatgccagcgcatccacgaatttgaaagatgtcctgtca
gacctcgtccctaaagaacagagcaggatcaagaacttcaaacagcagtatggcaaaacc
tcaattggtcagatcacggtggacatggtttatggaggaatgagaggggtgaagggttta
gtttacgagacatctgtactagaccctgatgagggcatccgtttccgtggttacagcatt
ccagagtgtcagcagttgttgcccaaggctcctggtggagaggagccactgccggagggt
ttgttctggttgctggtcacagggcaggtgcccactgaggagcaggtcagttggctgtct
aaggagtgggccaagcgcgcagcccttccctctcacgtggtcaccatgctggacaacttt
cccaccaacctgcaccccatgtctcagttcagcgccgccatcactgctctgaacagcgag
agcagcttcgctcgggcgtattctgagggagttaacaaggccaagtactgggagtttgtg
tatgaggactccatggacttgatcgccaagctcccctgcgtggcagctaagatctaccgt
aacttataccgtgaaggcagcagcatcggcgccattgactccaacctggactggtcacat
aacttcaccaacatgctgggatacaccgagccacagttcacagagctcatgaggctctac
ctcaccatccacagtgaccatgagggtggaaacgtgagcgcacacactagtcacctggta
ggaagtgcactatccgacccctacctctccttcagcgctgctatgaatggtctggcagga
cccctgcatggattggccaatcaggaggtgctggtgtggctgacagccctgcagaaggaa
ctcggtggtgaggtgtccgatgagaaaatgagagattacatttggaacacgctcaaatca
ggcagagttgtgccaggctatggtcacgctgtgctgaggaagacagaccctcgctacacc
tgtcagcgagagtttgccctcaagcaccttcccaatgaccctatgttcaagctggtcgct
cagctttacaagatcgtacccaatgtgcttctggagcagggcaaagccaagaatccctgg
cccaatgtagatgcacacagcggagtcctgttgcaatattacggcatgactgagatgaac
tattacactgtgctcttcggcgtatcccgggctttgggtgtcctcgcccagctggtgtgg
agcagagcgctgggcttccctctggagcgtcccaagtccatgagcacagacggactcatg
gctctagtcggggccaagtcaggctag

DBGET integrated database retrieval system