KEGG   Danio rerio (zebrafish): 322780
Entry
322780            CDS       T01004                                 
Symbol
nansa
Name
(RefSeq) N-acetylneuraminic acid synthase a
  KO
K05304  sialic acid synthase [EC:2.5.1.56 2.5.1.57 2.5.1.132]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00520  Amino sugar and nucleotide sugar metabolism
dre01100  Metabolic pathways
dre01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    322780 (nansa)
Enzymes [BR:dre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.56  N-acetylneuraminate synthase
     322780 (nansa)
    2.5.1.57  N-acylneuraminate-9-phosphate synthase
     322780 (nansa)
    2.5.1.132  3-deoxy-D-glycero-D-galacto-nonulopyranosonate 9-phosphate synthase
     322780 (nansa)
SSDB
Motif
Pfam: NeuB SAF DUF2458
Other DBs
NCBI-GeneID: 322780
NCBI-ProteinID: NP_996660
ZFIN: ZDB-GENE-030131-1500
Ensembl: ENSDARG00000045620
UniProt: Q6P0K4
Position
1:12335864..12344788
AA seq 359 aa
MPLKFELCPGRMIGGNNPCFIIAEIGQNHQGDIEIAKKMIKMAKDCGADCAKFQKSELEY
KFNKKALERPYTSKHSWGKTYGEHKRHLEFSHEQYRELQQYAKQVGIFFTASGMDEMAVE
FLHELDVPFFKVGSGDTNNFPYLKKTAQKGRPMVVSSGMQSMETMQHVYKIVKEHNQNFC
ILQCTSAYPLEPEDVNLRVITEYQKEFPDIPIGYSGHESGINITVGAVALGAKVVERHVT
LDKSWKGSDHAASLEPEELAELVRSIRIVERALGTGLKRMLPCEVPCHDKLGKSVVAKTS
IPKGTELTLDMLAVKVAEPKGVAPEEIFQLVGKKVTTDVEEDESITEDVVDSYGKKAKA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgccacttaaatttgaattatgtcccggccgcatgatcggaggaaacaatccgtgcttc
attattgcagaaatcggacagaatcatcagggagacattgagattgccaagaaaatgatc
aaaatggcaaaggactgtggtgcagactgtgcaaagtttcagaagagtgagctggagtat
aaattcaataagaaagctcttgaacggccatacacctccaaacactcctgggggaaaaca
tacggagagcataagcgacacctggagttcagtcatgagcagtacagggagctgcagcag
tacgctaaacaagtgggcatcttcttcactgcgtctggaatggacgagatggctgtagaa
ttcctccatgaactcgatgtgccttttttcaaagttggatctggcgacaccaacaacttt
ccttacctcaagaaaactgcccaaaaaggacgccccatggtagtgtccagcgggatgcag
tccatggaaaccatgcagcacgtttataagattgtcaaggagcacaatcagaacttttgc
atcctgcagtgcacaagtgcatatccacttgaacctgaggacgtcaacctgcgggttatc
acggaatatcagaaagaattcccagacattcccatcggttactcgggtcatgaaagtgga
atcaacatcacagtcggggcagttgctctgggagccaaagttgtggagcggcatgtgacc
ctggataagagctggaaaggtagtgatcatgcagcgtctctggaaccagaagagctggct
gagctggtgaggtccatccgcattgtggagagagctttgggcactggactgaaacgcatg
ctgccatgtgaggtgccatgccatgataagctcgggaagtcggtggtggcaaagacctcc
attccaaaaggtacagaactcacccttgacatgctggcagtgaaagtagctgaacccaag
ggtgtagctccagaagaaatcttccagctggtggggaagaaagtgaccacagatgtggag
gaggacgagagcattactgaagatgtagtcgacagctatggcaaaaaagctaaagcttga

DBGET integrated database retrieval system