KEGG   Danio rerio (zebrafish): 323266Help
Entry
323266            CDS       T01004                                 

Gene name
cd99l2
Definition
(RefSeq) CD99 antigen-like protein 2 isoform 3 precursor
  KO
K06520  CD99 antigen
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    323266 (cd99l2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:dre04090]
    323266 (cd99l2)
CD molecules [BR:dre04090]
 Proteins
  323266 (cd99l2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CD99L2
Motif
Other DBs
NCBI-GeneID: 323266
NCBI-ProteinID: NP_001315453
ZFIN: ZDB-GENE-030131-1986
Ensembl: ENSDARG00000056722
Vega: OTTDARG00000043745
UniProt: Q6DBW9
Position
7
AA seq 252 aa AA seqDB search
MEKTLWTWTLLAVFSLLVVKGMSDGLDLADALGDDDDDEPTTKPPKADPGAGGAGGAAVK
PTLKPVKPTVKEPAKPKPKQTGLDDFDLADALNPDNDIKGKGKDSGKGDKEVGGGSRDDG
TPNSRGSQFSDDDLLDVGNDNSYKPDKGKGGKGGSSSNVGDLDPADDNNYDTMAETGTIA
GIVSAVAMALVGAVSSYISYQKKKLCFSIQQSLNADMVKADAPDAVVAQEPQVQQTLLQP
PNAEPPTEENAV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggagaagacgctctggacatggacgcttctagcggtcttttctctgctggtagtgaaa
ggcatgagtgatggactagacctagcagatgcattaggtgatgatgatgatgatgaacca
actaccaagccacctaaggcggatcctggagcaggcggtgctggaggagcagcagtgaaa
cccactcttaaacctgttaagcccacagtcaaggaaccagcaaagcctaagcccaaacaa
acaggtttagatgacttcgatctcgcagatgccctaaaccctgacaatgacatcaaagga
aagggtaaagactctggcaaaggtgataaagaggtcggaggaggaagccgtgatgacggc
acccccaatagcagaggaagtcaattctcagacgatgaccttttggatgtgggaaacgat
aactcttacaaacccgacaaaggcaaaggtggaaaaggtggaagttccagtaatgttggt
gatttggatcctgctgacgacaacaactacgacaccatggctgagactggcactattgct
ggcatcgtgagcgctgtagccatggctctggttggtgcagtgagcagctacatctcctac
cagaagaagaagctgtgtttcagcatacagcagagtctgaatgcagatatggtgaaagca
gatgccccagatgctgtagtcgcacaggagccacaagtgcaacaaactcttctccagcct
cccaacgccgagccaccaacagaagaaaatgcagtttaa

DBGET integrated database retrieval system