KEGG   Danio rerio (zebrafish): 323613Help
Entry
323613            CDS       T01004                                 

Gene name
hexb
Definition
(RefSeq) beta-hexosaminidase subunit beta isoform 1 precursor
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00511  Other glycan degradation
dre00520  Amino sugar and nucleotide sugar metabolism
dre00531  Glycosaminoglycan degradation
dre00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dre00604  Glycosphingolipid biosynthesis - ganglio series
dre01100  Metabolic pathways
dre04142  Lysosome
Module
dre_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    323613 (hexb)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    323613 (hexb)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    323613 (hexb)
   00604 Glycosphingolipid biosynthesis - ganglio series
    323613 (hexb)
   00511 Other glycan degradation
    323613 (hexb)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    323613 (hexb)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     323613 (hexb)
Chaperones and folding catalysts [BR:dre03110]
 Intramolecular chaperones
  Others
   323613 (hexb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 323613
NCBI-ProteinID: NP_001108317
ZFIN: ZDB-GENE-030131-2333
Ensembl: ENSDARG00000034368
Vega: OTTDARG00000032626
UniProt: A2BHD8
Position
5
AA seq 541 aa AA seqDB search
MLCLLKFTPLFLVVAVCHGWLFGDLFEKQKELDEISLWPLPQKYQSSAVAFKLSAASFQI
VHAKQSTAGPSCSLLENAFRRYFEYMFGELKRQEKSRKKAFDSDLSELQVWITSADPECD
GYPSLRTDESYSLSVDETSAVLKAANVWGALRGLETFSQLVYEDDYGVRNINKTDISDFP
RFAHRGILLDSSRHFLPLKVILANLEAMAMNKFNVFHWHIVDDPSFPFMSRTFPELSQKG
AYHPFTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGNGIKDLLTPCYSGSSPSG
SFGPVNPILNSSYEFMAQLFKEISTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMNQQGFG
TDYSKLESFYIQRLLDIVAATKKGYMVWQEVFDNGVKLKDDTVVEVWKGNDMKEELQNVT
GAGFTTILSAPWYLDYISYGQDWQRYYKVEPLDFTGTDAQKKLVIGGEACLWGEYVDATN
LTPRLWPRASAVAERLWSDASVTDVGNAYTRLAQHRCRMVRRGIPAEPLFVGHCRHEYKG
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctctgtctgctcaagtttacccctctgtttttggtggtagccgtatgtcacggctgg
ctttttggagatctttttgaaaaacagaaagagctggatgaaatctctctatggcctcta
ccgcagaaataccagtcgtccgcggtcgcttttaaactcagcgccgccagctttcaaatc
gtccacgccaaacagtccaccgccggaccgagctgcagtctactcgagaatgcatttcgc
agatattttgaatacatgtttggagagctgaaaaggcaggagaaaagccgaaagaaagcg
tttgattcagatctctcggagctgcaggtatggatcacatcagctgatccggagtgcgac
ggttacccgagtcttcgaaccgacgagtcatattcgctgtcggttgatgaaacctcagct
gtgctcaaagctgctaatgtatggggagctttgcgaggactggaaacattcagccagttg
gtctatgaggatgactatggagttagaaatattaataagaccgacatatcagattttcca
cggtttgcccaccgaggaatccttctggactcgtctcgccattttctgccactcaaagtc
attttggccaacttggaagctatggccatgaacaagtttaacgtcttccactggcacatt
gtggatgatccgtcgtttccttttatgagccgtactttcccagagttgagccaaaaggga
gcctatcacccatttacacatgtgtacactccatctgatgtgaagatggtcattgaattt
gctcgcatgagggggatcagggtcgttgcggagttcgacaccccagggcacacgcagtca
tggggcaatggcataaaggatctgctaacaccttgttacagtggctctagtccttcagga
tcatttgggcccgtgaaccccatcttaaactcctcttatgagttcatggcacagcttttc
aaagagatcagcaccgtctttcctgacgcttacattcacctagggggagatgaggtcgac
ttttcttgttggaagtccaatcctgatattcagaagtttatgaatcagcaaggctttggc
acagactacagcaaactggagtccttctacattcaaaggttacttgatattgtggctgct
accaaaaaaggttacatggtgtggcaggaggtgtttgataacggggtcaagctaaaggat
gacactgttgtggaggtgtggaaagggaacgatatgaaggaggagctccagaatgtgact
ggggcaggatttacaaccattctttctgccccttggtacctggactacattagctatgga
caggactggcaacgctactacaaagttgagccacttgatttcactggcacagatgcacag
aagaagctggtgattggtggagaggcttgtctttggggagagtatgtggacgccaccaac
ctcactcctcgactctggccaagagccagtgccgtcgctgagaggttatggagtgatgca
agcgtgaccgatgtcggaaatgcttatactcgcctggcccagcatcgctgccgcatggtc
aggagaggcatacctgcagaacctctatttgttggccactgccgtcatgagtacaagggt
ctgtga

DBGET integrated database retrieval system