KEGG   Danio rerio (zebrafish): 323919
Entry
323919            CDS       T01004                                 

Gene name
alcamb
Definition
(RefSeq) activated leukocyte cell adhesion molecule b precursor
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig C2-set_2 I-set V-set C1-set Syndecan Flg_new Big_7 SKG6 EVC2_like
Other DBs
NCBI-GeneID: 323919
NCBI-ProteinID: NP_997799
ZFIN: ZDB-GENE-030131-1768
Ensembl: ENSDARG00000058538
Vega: OTTDARG00000027920
UniProt: F1QE54
Position
15
AA seq 562 aa
MQRTAFLTCLLTVSLMNQVCGLETVTGKYGDTVEIPCNSGLVSDVGVTFVKWKSDKDGSI
LVKHTGQNASSPTDGNYKNRVSIKKDFGLIITQVSLADQKTFTCMVVAADDILEYPVQLV
IYKTPLQPQIANLTTAMEIGKLTTLAQCHTEGANPAANITWFKNKTPLIADGTAIKITND
VAVDKATGLSATTSKLEYTAVKDDINSKFTCQVQHIKSANMDSSPLVFTVNYPSETISFH
VLPDGPVKEGDNVTLKCTADGNPPPSRYNFYIKGEKKTVEKSNIFILSNVTRQNTGEYKC
SLVDNEILTASKNITVEYLDVILSTTGEVFKKLGDSFETTLDIKASGKTETFCKKGGEKM
VGPPKFASLKYTDSGVYECVVTMLGLKKTQTFDLNVHGQPLIKSLTKKRGDGTNKILSCE
AEGSPKPTVQWITNGTDVKFQESEHVNGKITYYITVSPKANVTVSCTISNDLGSDTRSID
VSSLVEDVTMDKQDQSEDYSDQTALAVGIVVGLMLAALLIGLAYWLYMKKFRQGSWKTGE
KEDGSAEESKKLEENQSQKAEV
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgcagcggaccgcctttttaacgtgtctgctcaccgtgtccctcatgaatcaagtgtgt
ggtttggaaacggtcactggcaagtacggagacactgttgaaatcccatgcaacagtgga
cttgtctcagacgtaggagtcacgtttgttaagtggaaatctgacaaagatggcagcatt
ctggtaaaacacacgggtcagaatgcctcctctcccactgatggtaactacaagaacaga
gtcagtattaaaaaagattttggtctcatcatcacacaagtgtccctggcggatcagaaa
accttcacctgcatggttgtggcagcagatgacattttggagtatcctgtccaactggtc
atttacaagactccattgcagcctcagattgcaaacctaaccactgcgatggaaatcgga
aagctgactacattggcacagtgtcatactgaaggtgccaatccagctgccaacatcacg
tggttcaagaacaaaactccgcttattgctgatggaacagccattaaaatcaccaatgat
gtggctgttgataaagcgacaggactgtctgccactacatctaagctggagtacactgca
gtgaaggatgacattaattccaagtttacctgtcaggttcagcacattaagtctgctaac
atggattcctcaccgctcgtcttcaccgtgaactacccttcggagacgatcagtttccat
gtgctgcccgatggtcctgttaaagaaggagacaatgtgaccctcaaatgcacggcagac
ggaaaccccccaccctctcgctacaacttctacatcaagggagagaagaagacagtggag
aaatcgaacatctttatcttgagtaatgtaactaggcaaaacaccggagaatacaaatgt
tcattggtggataatgagatattgacggcgtctaaaaatatcaccgttgaatatcttgat
gtgattcttagcaccactggtgaggttttcaagaaacttggcgatagctttgaaacaact
ctcgatattaaagcttcaggaaaaacagaaaccttttgtaagaagggtggtgaaaagatg
gttggccctcctaaatttgccagcttaaagtacacagactctggtgtgtatgagtgtgtt
gttacaatgcttggcctcaagaagacacagacatttgacttgaatgttcatgggcaacca
ctgatcaagagcctgaccaagaagcgtggtgatggtacaaacaagatcctgagctgtgaa
gctgaaggatcaccaaagccaacggtgcagtggattaccaatggcacagatgtgaaattt
caagagagcgaacatgtgaatggaaagatcacatactatatcactgtcagtccaaaggcc
aatgtcactgtgtcctgcacaatctccaatgatttgggttctgacacgaggagcatcgat
gtgtcgtcgcttgttgaggacgtgacaatggacaaacaagatcagtcagaggactacagt
gaccagacggcgctggctgttggcattgttgttggcttgatgctggcagcacttttgata
ggactggcctactggctgtatatgaagaaattcaggcaaggatcctggaaaaccggagag
aaggaagacgggtcagcagaggagagcaagaagctggaggagaatcagagccaaaaagct
gaagtgtaa

DBGET integrated database retrieval system