KEGG   Danio rerio (zebrafish): 324243Help
Entry
324243            CDS       T01004                                 

Gene name
stub1
Definition
(RefSeq) E3 ubiquitin-protein ligase CHIP
  KO
K09561  STIP1 homology and U-box containing protein 1 [EC:2.3.2.27]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04120  Ubiquitin mediated proteolysis
dre04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    324243 (stub1)
   04120 Ubiquitin mediated proteolysis
    324243 (stub1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dre03110]
    324243 (stub1)
   04131 Membrane trafficking [BR:dre04131]
    324243 (stub1)
   04121 Ubiquitin system [BR:dre04121]
    324243 (stub1)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     324243 (stub1)
Chaperones and folding catalysts [BR:dre03110]
 Other chaperones and cochaperones
  Others
   324243 (stub1)
Membrane trafficking [BR:dre04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    324243 (stub1)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  U-box type E3
   324243 (stub1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: U-box CHIP_TPR_N TPR_1 TPR_2 ANAPC3 TPR_11 TPR_8 TPR_16 TPR_12 TPR_7 TPR_17 TPR_19 TPR_9 Paf67 SRP_TPR_like DUF3808 Coatomer_E NRBF2_MIT zf-NOSIP SHNi-TPR
Motif
Other DBs
NCBI-GeneID: 324243
NCBI-ProteinID: NP_955968
ZFIN: ZDB-GENE-030131-2963
Ensembl: ENSDARG00000045228
Vega: OTTDARG00000028670
UniProt: F1Q8K3
Structure
PDB: 

Position
24
AA seq 287 aa AA seqDB search
MEKMASSPEKSSSAQELKEQGNRLFLSRKYQEAVTCYSKAINRNPSVAVYYTNRALCYVK
LQQYDKALADCKHALELDSQSVKAHFFLGQCQLELENYEEAIGNLQRAYNLAKEQRLNFG
DDIPSALRIAKKKRWNSIEEKRISQENELHAYLSKLILAEKERELDDRVKQSDDSQNGGD
ISKMKSKHDKYLMDMDELFSQVDEKRKKREIPDYLCGKISFELMREPCITPSGITYDRKD
IEEHLQRVGHFDPVTRSPLTQDQLIPNLAMKEVIDAFIQENGWVEDY
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggagaagatggcgagcagcccagagaaaagctcatccgcacaggagctgaaggagcag
ggaaaccgcctgttcctcagccgcaagtaccaggaggccgtcacctgctacagcaaagcc
atcaatcgtaacccatcagtggccgtgtactacactaacagagcgctatgctacgtcaag
ctacagcagtacgacaaggcactggccgactgtaaacacgccctcgagctcgacagccaa
tcggtgaaggcgcacttttttctgggccaatgtcagctggagctggagaattacgaagaa
gccatcggcaacttacaaagagcctataacctggcgaaggaacagaggctcaattttgga
gacgacatcccaagtgctcttcgcatcgccaagaagaaacgctggaacagcatagaggag
aagcggatcagccaagagaacgagctgcacgcctatctcagcaaactcatcctggccgag
aaggagagagagctggacgaccgagtgaagcagtcagatgacagtcagaatggaggagac
attagcaagatgaagtccaagcatgataagtatctgatggacatggatgagcttttctct
caagtagatgaaaagaggaagaaacgcgagatccccgattacctgtgtgggaagatcagc
ttcgagctgatgagggaaccctgcattactcccagcggcatcacctacgaccgcaaggac
atcgaggagcatctacagcgtgttggccattttgaccccgtcacgcgtagtcctctgacc
caagatcagctgatccccaacctggccatgaaggaggtgatcgacgctttcatccaggag
aacggctgggtggaggactactga

DBGET integrated database retrieval system