KEGG   Danio rerio (zebrafish): 324469
Entry
324469            CDS       T01004                                 

Symbol
wu:fc30c06
Name
(RefSeq) uncharacterized protein LOC324469
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zinc_ribbon_15 Zn-ribbon_8 zf-C2H2_11 TRAF6_Z2 C1_1 Zn_ribbon_SprT zf-H2C2_5 HypA GATA zf_UBZ zf-LYAR Sa_NUDIX zf-C2HE
Other DBs
NCBI-GeneID: 324469
NCBI-ProteinID: NP_001314845
ZFIN: ZDB-GENE-030131-3190
Ensembl: ENSDARG00000103865
Vega: OTTDARG00000044201
UniProt: A0A0R4ISU2
Position
4
AA seq 424 aa
MRLLPPCDAIMKMAFIKEESEDLRIEETFRREDIRIAEVFSLKQEDPEEQTDLTELKKEQ
EQLRDPIKEDQDFKTEHEDSTHSQTEVIQSSLTCNQCGKSFTHKQNLRVHMRVHTGEKPY
RCSQCGLSFTRKQTLNGHMSIHSGVKPYLCAQCGLTFSYRKNLNLHMRIHTGEKPYSCTR
CELSFRKKQCLKIHMRIHTGEKPYLCAQCGLSFTHKQTFNSHTRNHTGEKPHTCAQCGSS
FATKQSLRIHTRIHTGEKPYMCSQCGIGFTHKNALNVHFTSHTGEKPYICHQCGSGFTRK
HALNTHLVIHTGQKPHKCSECGLSFTKKTALNSHVRIHNAVKPYTCSHCGQSFKHKQTLN
IHRRVHTGEKPYSCTQCGQSFPHKQTLRSHLRIHTGEKAYACSQCGMSFMYRRGLNVHVR
SHFQ
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcgacttttgcctccatgtgacgctataatgaaaatggcgtttattaaagaggagagt
gaagacctgaggattgaagaaacgttcagacgtgaagacatcaggattgcagaagtgttc
tcgctgaaacaagaagatcccgaggaacaaacagatctgactgaactaaaaaaggagcag
gaacaactgagggatccgatcaaggaagatcaagatttcaaaactgaacacgaagattcc
actcactcacagacagaagtaatccagagctctctcacatgcaaccaatgcgggaaaagt
ttcacccacaaacaaaatctgagggtccacatgagagtccacactggagaaaagccctac
aggtgctctcaatgcggattgagtttcacgcgtaaacaaactctcaacggccacatgagc
attcactccggagtgaagccttatctgtgtgcccaatgcggactgaccttttcataccgg
aaaaatcttaatctgcacatgagaattcacaccggagagaagccctactcgtgcacccga
tgtgaactgagttttaggaagaagcaatgtcttaaaatccacatgagaattcacaccggc
gaaaagccgtacctgtgtgcccaatgcggactgagttttacgcacaaacaaacttttaac
agccacacgaggaatcacacgggagagaagcctcacacgtgtgctcaatgcggatcgagt
tttgccactaagcaatctctccgtatccacacgcgcattcacaccggcgaaaagccttac
atgtgctcccaatgcgggataggtttcacacataaaaatgctcttaatgtccacttcact
tctcacaccggagagaagccctacatctgccatcaatgcggatctggtttcacacgtaaa
catgctcttaacacccacctggtaattcacaccggacagaagcctcacaagtgctctgaa
tgtggactgagttttacgaaaaaaacggctcttaatagccacgtcaggattcacaacgca
gtaaagccgtacacgtgctcccactgtggacagagctttaagcacaaacaaactcttaat
atccatcggagagttcacaccggagagaagccgtactcttgcactcagtgtggacagagt
tttccgcataaacagactctccgtagccacttgagaattcacaccggagagaaggcttac
gcgtgctctcaatgcggaatgagctttatgtatagacgaggtcttaatgtccatgttagg
agtcacttccagtaa

DBGET integrated database retrieval system