KEGG   Danio rerio (zebrafish): 324724Help
Entry
324724            CDS       T01004                                 

Gene name
dicer1
Definition
(RefSeq) endoribonuclease Dicer
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    324724 (dicer1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     324724 (dicer1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    324724 (dicer1)
   microRNA pathway
    RISC loading complex
     324724 (dicer1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuclease_3 PAZ Ribonucleas_3_3 Dicer_dimer Helicase_C DEAD ResIII dsrm
Motif
Other DBs
NCBI-GeneID: 324724
NCBI-ProteinID: NP_001154925
ZFIN: ZDB-GENE-030131-3445
Ensembl: ENSDARG00000001129
Vega: OTTDARG00000020346
UniProt: Q6TV19
Position
17
AA seq 1865 aa AA seqDB search
MAGLQLVTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALEHNTIVCLNTGSGK
TFIAVLLIKELSHQIRGENGKRTVFLVNAASSVAQQASTVRTHSDLQVGDYMSEDMTSWP
EEMWNREMIENQVLVMTCHIFLHVLKNGVLPLSKINLLVFDECHLAITGHPYREIMKICE
GCPSCPRILGLTASILNGKCDPCDLEEKIQNLEKILQSNAETATDLVVLDRYASQPREEV
LDCGQYQDQSGLSERLLNELDEALNFLNDCNLSVHREDRDPTFISKQVLNDCRAVLTVLG
PWCADKAAGIMVRELQKYIKHEQEELNRKFLLFTDTILRKIHALCEEHFSPASLDLKFVT
PKVIRLLEILHEYKPFERQQFESVEWYNNRNQDNYVSWSDSEDDDEDEEAEAKEKTEANF
PSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQPRNKQM
EVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRAR
APVSNYIMLADSERTKTFQEDLKTYKAIEKILRNKCSKSAECNDFELEPVTDDDNVLPPY
VLRSEDGGPRVTMNTAIGHVNRYCARLPSDPFTHLAPKCKTVEMNTGGYRSTLFLPINSP
LRVPVTGPVMNCARLAEKAVALLCCEKLHKIGELDDHLMPVGKETVKYEEELDLHDEEET
SVPGRPGSTKRRQCSPKAIPECLRGCYPVPEQPCYLYVIGMVLTTPLPDELNFRRRKLYP
PEDTTRCFGILTAKPIPRIPHFPVYTRSGEVTISIELQKSGFSLSAEQLELITRLHQYIF
SHILRLEKPALEFKPVEADSAYCVLPLNIVEDSNTLDLDFKFMEDIEKSEARIGIPNTQY
TKQNPFIFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKT
KYNLDLSNVNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILV
PELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRSQTAIDAGVGAQTLPPDFRYPNL
DFGWKKSIDSKSFISCPSACMEEDDDHCKLGTSSDSNHTAPESCSMEVSQPPEGAPNTPD
EKLETLTLPVTDLNKDCFPNLPNGTQADSDDLPHRSDVCQCSQLGPLERDLSTQTTTSVS
VRPSPAGEPQPWPSDECTGRSSDLCDPHVKKPTSKHCPKSETATSTPAPSETSSEDCRSA
CAGPAWDSPKTLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDA
HEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSSTDKWD
SDENKDLANGKASDDEDEDDDDEPEEAEVEPSKEDVNVEDDLEYYYEHIRFIDSMLIGSG
AFGKKISLQPTDPGYEWKAPKKAHNSHFSPDGGADEFDYSSWDAMCYLDPSKAGEEDDFV
VGFWNPSEENCGTDIGKQSISYDLHTEQCIADKSIADCVEALLGCYLTSCGERAAQLFLC
SLGLKVLPPEKQSSGGSAELQYGWLKIPPRCMFEHPDAERTLNHLISGFLNFESKINYTF
KNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRS
ALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEE
KEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVREL
LEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQP
QVQNN
NT seq 5598 nt NT seq  +upstreamnt  +downstreamnt
atggctggcctacagctggtgacccctgcctcctcacccatggggcccttctttggtctc
ccgtggcaacaggaagctatccatgacaacatatacacaccaaggaaatatcaggttgaa
cttcttgaagcagctcttgaacataatactatagtctgcttaaatactggctcagggaag
acctttatcgcagtgctcctaatcaaagaactctcccaccaaattcgtggcgagaatggg
aagaggacagttttcctggtgaatgcagcgtcatctgtggctcagcaagcatctactgta
agaacacactctgatctccaagtaggcgactatatgtcagaggacatgacatcatggccc
gaggagatgtggaacagagagatgatagagaatcaggtgctggtgatgacgtgccacatc
ttcctgcatgttttaaagaatggagtcttgccactatcaaagatcaacctgctggttttt
gacgaatgccaccttgcaatcactggccatccttatcgggaaataatgaagatttgtgaa
ggttgccccagctgtcctcgcattttgggtctcactgcttccattttaaatggcaaatgt
gacccttgtgatttggaggagaaaattcagaacctggagaagattcttcagagcaatgca
gaaactgccactgatcttgtggtgctggataggtatgcgtcgcagccgcgtgaggaggtg
ctggattgtggacagtaccaagatcagagtgggctctcggagaggcttttaaatgagctg
gacgaagccctcaattttctaaacgattgcaacttgtctgtacatagagaagatagagac
cccacgtttatctccaaacaggtgctgaatgactgtcgtgctgtgttgactgtgctgggc
ccttggtgtgcggataaagctgcaggaatcatggttcgggagctgcagaaatatattaaa
catgaacaggaagagctaaaccgcaagttcctgttgttcaccgacaccatcctgaggaaa
atccatgccttatgtgaggagcatttttccccagcttccctcgacctgaagtttgtcact
cccaaggtcatcagacttttggagattctccacgagtacaagcctttcgaacggcagcag
tttgagagtgtggagtggtacaacaatcgcaatcaggacaattatgtttcttggagtgat
tctgaagatgatgatgaggacgaagaggcggaggcaaaggagaaaaccgaagcaaatttt
ccctcgccgttcacaaatatcctctgtggaatcatctttgtggaaaggcgatatacagcg
gttgttttaaacagacttattaaggaggcaggaaagcaagacccagagctggcttacatc
agtagcaacttcatcacagggcacagcatcggcaagaaccagcctcgcaacaagcagatg
gaggtggagttcagaaaacaagaggaagtcttgaggaaattcagagcccatgaaaccaac
ttgctcattgcaaccagcattgtggaggaaggcgtcgatatcccaaagtgcaatttggtc
gttcggtttgacctgccgacagagtaccggtcgtacgtgcaatccaaaggtcgagcccgt
gctccagtctccaactacatcatgctagcagacagcgaacggactaaaaccttccaagaa
gacctcaagacctacaaggccatagagaagatcctccgaaataagtgctcgaagtcggct
gaatgcaatgattttgagctggagcctgtgaccgatgacgacaatgttctcccaccgtac
gtcctgcgctcagaggacggcgggcctcgtgtcaccatgaacactgccattgggcacgtc
aaccgatattgtgcgcgcttgcccagtgatccgttcactcatctcgctccgaagtgtaaa
actgtagagatgaacaccggagggtatcgatccacactcttcctacctatcaactcacca
ctcagagttcctgtcaccgggccagtaatgaattgtgcaagactggctgagaaagctgtc
gctcttctctgttgtgaaaaactccacaaaattggtgaactggatgatcatctgatgcct
gtgggaaaggaaactgtgaagtatgaggaggagctggacctgcatgatgaagaggagaca
agcgtgccaggaagaccaggctccactaaacggagacagtgctccccaaaagccatacca
gagtgtctgcggggttgttaccctgtgccagagcagccttgctacctttacgttattggg
atggtcctcaccacccctctacctgacgaactcaacttccggcggaggaagctgtatcca
ccagaggacacaacccgatgttttggcattctgacagctaaaccaataccccggatccct
catttccctgtgtacactcgttctggtgaggtgaccatctccattgagctgcagaagtcg
ggctttagtctaagtgcggagcagctggagctgatcacacgtctgcatcagtacatcttc
tcccacatcctccgtctggaaaagccagcactagagtttaagcctgtagaggcagattct
gcctactgtgttctacctctcaacatcgttgaggattccaatactttggatctggatttc
aagttcatggaggatattgaaaagtctgaagcacgcattggcattccaaacactcagtac
accaagcaaaacccattcatcttcaaattggaggactaccaggatgctgtcatcattcca
aggtatcgtaattttgaccagccgcatcggttctacgtggctgacgtttacacagacctc
accccgctcagtaaattcccctctccagagtacgagacttttgccgaatactataaaacc
aagtacaacctggacctgtcaaatgttaatcagcccctactggatgtggaccacacatct
tcaagattgaatcttttaactccccggcaccttaatcaaaaggggaaagcccttcctctc
agcagtgcggagaagagaaaggccaagtgggaaagcctacaaaacaaacagattttagtt
ccggagctctgtgccattcaccccatcccagcctctttgtggaggaaagccgtctgcctt
cccagcattctctatagacttcactgccttctgacggccgaagagctgcggtctcagaca
gccatcgatgctggcgtaggggctcagaccttgcctcctgatttcaggtatcctaatttg
gatttcggatggaagaaatccatcgacagcaagtctttcatctcctgccccagtgcatgt
atggaagaagacgacgatcactgtaaactcggcacaagctccgattcaaaccacactgcc
cccgagagctgcagtatggaggtctcccagcctccagaaggcgctcccaacacaccagat
gaaaagctagaaaccctcactctccctgtgactgatctaaacaaagactgtttcccaaac
ctcccaaacggcactcaggccgacagcgacgacctccctcacagaagtgacgtttgccaa
tgctctcagctgggccctctggagagagacctatcaacacaaaccactacctcagtttca
gtgcggccctctccagctggagaaccacagccatggcccagcgatgaatgtacaggcagg
agctcggatctctgcgacccacatgtgaagaaacctacctcaaagcattgccctaaatcg
gagacggcgactagcaccccagcaccttcagaaacgtcatcagaggactgtagatcagcc
tgcgctggtccagcctgggattcgcccaaaaccctgggcccgaaccccgggctcatcctg
caggccctgactctctccaacgccagtgacggcttcaatctggaacgcctggagatgctg
ggcgactccttcctgaaacacgccatcaccacatacctgttctgcacttaccctgacgcc
cacgagggcagactgtcctacatgagaagcaagaaggtcagcaactgtaacctgtatcgg
ctggggaagaagaagggtcttccgagtcgaatggtggtgtccatctttgacccgccggta
aactggcttcctccaggctacgtcgtgaatcaggacaaaagcagcacagacaagtgggac
tcagatgagaataaagatttagcgaatggaaaagccagcgatgacgaagacgaggatgac
gatgatgagccggaagaagcagaggtcgagccatctaaagaagatgtaaatgttgaagac
gacctggagtattattacgaacacatccgcttcatcgacagcatgttaatcggctctggc
gctttcggcaagaagatctccctccagcccacagaccccggctacgaatggaaagctcct
aaaaaagcccacaactcccacttctcgccagacgggggtgctgacgagttcgattacagc
tcctgggacgccatgtgttacctggaccccagtaaagcaggtgaggaggacgatttcgtg
gtgggcttctggaatccctctgaggaaaactgcggcacggacatcgggaaacagtccatc
tcttatgaccttcacacggagcagtgcatcgcagataagagcatagcggactgtgtggag
gctctgctgggctgctatctgaccagctgtggtgagcgagcggctcagctgtttctctgc
tctctgggcctgaaggtgctaccaccggagaagcagagttcgggaggctctgccgagctc
cagtacggctggctgaagatcccaccacgctgcatgttcgaacatcctgacgctgaacgc
acgctcaaccacctcatctctggcttcctgaacttcgagagcaagatcaactacacgttt
aagaacaaggcgtacctgctgcaggccttcacacacgcctcgtatcattacaacaccatt
acagattgttatcagcggttggagtttcttggtgatgcaattctagactacctcataacc
aagcacctttatgaagacccccggcagcactcgcccggcgtgctgaccgacctgcgctct
gcacttgtcaacaacaccatattcgcttccctggctgtcaagtatgattaccacaagtac
ttcaaagctgtctcgccagaactcttccacgtgatcgacgattttgtgcaatttcaactg
gagaagaatgaaatgcaaggaatggattcagagcttcgccgatcggaggaagatgaagag
aaagaggaagacattgaagtccccaaagcaatgggagacatctttgaatcgctagctggt
gcaatttacatggatagcgggatgtcacttgagacagtttggcaagtgtattatccaatg
atgaggccgctcatagaaaaattctccgctaatgtccctcgatccccagtgcgtgaactc
ctggagatggagccagagacagctaagttcagccctgcggaaagaacttatgatggaaag
gtacgggtgacggtggaagtcgtgggcaaaggcaagttcaaaggcgtaggacgcagctac
cggatagccaagtcagcagccgcccgccgagccctgcgcagtctcaaagccaaccaacct
caggtccaaaacaactga

DBGET integrated database retrieval system