KEGG   Danio rerio (zebrafish): 324931
Entry
324931            CDS       T01004                                 

Symbol
sp8b
Name
(RefSeq) transcription factor Sp8
  KO
K09198  transcription factor Sp8
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    324931 (sp8b)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    324931 (sp8b)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-Di19 zf-C2H2_8 zf-C2H2_6 DUF5810 zf-H2C2_5 zf-C2H2_9
Other DBs
NCBI-GeneID: 324931
NCBI-ProteinID: NP_991113
ZFIN: ZDB-GENE-030131-3654
Ensembl: ENSDARG00000056666
Vega: OTTDARG00000020888
UniProt: Q6P0J3
Position
16
AA seq 437 aa
MLAATCNKIGSPSPSPSSISDNSSSFGKGFHPWKRATASSCSLGSSLSSFTRNGGGLSDS
FGTNTSTGSSAFSLTSGTSSNSHFGNDYSVFQTSVSNNSQEPSHQPMFISKVHTSVDSLQ
SIYPRMSVAHPYESWFKSSHPGIPTGDVGTTGASAWWDVGAGWIDVQNPNGAALQTSLHS
GGLQTSLHSPLGGYNSDYSSLSHSAFSTSASPHLLTTGQHLMDGFKPVLSSYPDSSPSPL
GGAGGSMLTGGPTASLAGSPRSSARRYSGRATCDCPNCQEAERLGPAGASLRRKGLHSCH
IPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACP
VCNKRFMRSDHLSKHVKTHSAGGSSGSGSGASGGKRGSDTDSEHSVPGSPSCHSPDLLQA
PESVPTTGMNGRASSLD
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgttggctgcgacgtgtaacaaaatcgggagcccgagtccttctccttcctcgatttcg
gataattcatcttcgttcggaaaaggattccacccgtggaaacgagcgacagccagcagc
tgtagtttaggatccagtttatcctctttcactcggaatggtggtggtttaagcgactct
tttggcacgaacacttctacgggatcaagtgccttttccttaacttctggtacttcgtcc
aactcccacttcggaaacgactactccgttttccagacttctgtgtcaaataactcccaa
gagccaagccaccaacccatgtttatttcaaaagtgcacacatccgtggacagtttgcag
agcatttacccgagaatgagcgtggcgcatccctacgagtcgtggttcaagtcctcacac
cctggcatacccacgggggatgtgggcaccacgggcgcatccgcgtggtgggacgtggga
gccggttggattgatgtgcagaacccgaatggagctgcgctccagacgtccctacactcc
ggtgggctgcaaacttctttacactctcctctgggcggatacaactcagactactcgagt
ttaagccactctgccttcagtaccagcgcgtccccgcatctcctcaccaccgggcagcac
ctcatggacggattcaaaccggttctctcgtcttacccggactccagtccttctcctctg
ggtggagcgggtggttccatgttgacagggggtccgacggcctctttggcggggtccccg
cggtcttccgcgcggcgctactcgggcagagcgacgtgtgactgtccgaactgtcaagaa
gctgagcggctgggtccggccggcgcaagcctccgcagaaaggggctgcacagctgtcac
atccctggctgtgggaaagtgtacggcaaaacgtctcacctcaaggctcatttgaggtgg
cacaccggggaaaggccgtttgtgtgtaactggttattctgtggaaagaggttcacgcgc
tccgacgagctccagcgacatttacgcacgcacaccggcgagaagcgcttcgcttgtccc
gtgtgcaacaagcgcttcatgcggagtgaccacctcagtaaacatgtcaaaacgcacagt
gctgggggctcgtcagggtcggggtctggggcgagtggagggaaacgagggagtgacacc
gacagcgagcacagtgtgcccggtagcccctcatgccattcgcctgacctgttgcaagcc
cccgagtctgtcccgaccactggaatgaacggccgtgcaagctccctcgattaa

DBGET integrated database retrieval system